Basic Information | |
---|---|
IMG/M Taxon OID | 3300013382 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118445 | Gp0134418 | Ga0116618 |
Sample Name | Baboon gut microbial communities from fecal samples in Kenya - F09 |
Sequencing Status | Permanent Draft |
Sequencing Center | Duke University |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 84509753 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Enterocloster → Enterocloster asparagiformis | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Baboon Gut Microbial Communities From Fecal Samples In Kenya |
Type | Host-Associated |
Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | ||||||||
Coordinates | Lat. (o) | 2.717 | Long. (o) | 37.1 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F076190 | Metagenome | 118 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0116618_102355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Enterocloster → Enterocloster asparagiformis | 4234 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0116618_102355 | Ga0116618_1023552 | F076190 | VRTAGGSITISAKNVFTAASRVSGHVWSLVRITIPNGLKSVKIRVEKPQNNFLYPYFQREPL* |
⦗Top⦘ |