3300011279: Marine microbial communities from the Southern Atlantic ocean - KN S19 NT30 metaT (Metagenome Metatranscriptome) (version 2)

Overview

Basic Information

• IMG/M Taxon OID: 3300011279
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114292 | Gp0125917 | Ga0138400
• Sample Name: Marine microbial communities from the Southern Atlantic ocean - KN S19 NT30 metaT (Metagenome Metatranscriptome) (version 2)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 16889717
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Southern Atlantic Ocean
• Coordinates
  • Lat. (^o): -28.2362
  • Long. (^o): -38.4949
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032301	Metagenome / Metatranscriptome	180	N
F060086	Metagenome / Metatranscriptome	133	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0138400_141471	Not Available	743

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0138400_141471	Ga0138400_1414711	F032301	VASKLSPQQAGKKKMRVAMEFREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLPARSWEMPVKCELPAKIGRCSKNLAGRNF
Ga0138400_145087	Ga0138400_1450871	F060086	NLLLSVDQHGEDRKRQLISINDHETPLLDDLADLLY*