3300010015: Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #4 sample B4

Overview

Basic Information

• IMG/M Taxon OID: 3300010015
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0120461 | Gp0151272 | Ga0133907
• Sample Name: Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #4 sample B4
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Maryland
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 98305237
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	3

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Black Band Disease Transitions
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: Belize: Carrie Bow Cay Field Station
• Coordinates
  • Lat. (^o): 16.80288
  • Long. (^o): -88.08213
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003577	Metagenome / Metatranscriptome	478	Y
F039942	Metagenome / Metatranscriptome	162	Y
F085126	Metagenome / Metatranscriptome	111	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0133907_1023628	Not Available	608
Ga0133907_1024867	Not Available	586
Ga0133907_1024913	Not Available	585

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0133907_1023628	Ga0133907_10236281	F039942	SGLENIPLFAGNRAEVSQNHDARKAVSATLSVLKLSGAIFRPISSKVSVQKVLLCPFNCKLRPSEVSLASPGIENIRQLPGNRAEVGQNYDARKAVSATLSVLK*
Ga0133907_1024867	Ga0133907_10248671	F085126	DCKPRPSGVSLESPGLENILQVPGNGAEVDENYDARNGLSAILSVLNLSRAIFRP*
Ga0133907_1024913	Ga0133907_10249131	F003577	LGACFSLKVKYGYISAHKLESERSKSFAVSISLQNKAIGT*