3300009398: Microbial communities from sand-filter backwash in Singapore swimming pools - JW-2

Overview

Basic Information

• IMG/M Taxon OID: 3300009398
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118565 | Gp0137166 | Ga0115921
• Sample Name: Microbial communities from sand-filter backwash in Singapore swimming pools - JW-2
• Sequencing Status: Permanent Draft
• Sequencing Center: Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 165808734
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Communities In Swimming Pool Backwashes
• Type: Engineered
• Taxonomy: Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash → Microbial Communities In Swimming Pool Backwashes

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Singapore
• Coordinates
  • Lat. (^o): 1.28967
  • Long. (^o): 103.85007
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077438	Metagenome / Metatranscriptome	117	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0115921_1137225	Not Available	620

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0115921_1137225	Ga0115921_11372252	F077438	VYSTERVELSFRESRFETLFLWNLQVEISSALGPKAEKEISSYKN*