NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009329

3300009329: Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 900m, 2.7-0.2um, replicate b



Overview

Basic Information
IMG/M Taxon OID3300009329 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118094 | Gp0137038 | Ga0117912
Sample NameMarine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 900m, 2.7-0.2um, replicate b
Sequencing StatusPermanent Draft
Sequencing CenterGeorgia Genomics Facility
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size394865577
Sequencing Scaffolds2
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecoastal water bodycoastal sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031797Metagenome / Metatranscriptome181Y
F037999Metagenome / Metatranscriptome167Y
F060598Metagenome / Metatranscriptome132Y
F083361Metagenome / Metatranscriptome113Y
F085858Metagenome / Metatranscriptome111Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0117912_1038520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium2113Open in IMG/M
Ga0117912_1104141Not Available993Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0117912_1005413Ga0117912_100541311F031797CFALWQLDPVSRERAKEMGMELRSTAAGPNHIRVELELKPEGELKDFGRVDLHFGEGDNPPLTAPLREDRSKPGRVVVNFTAKRTQLDKIKLWVIVPFMTGGTAYELRVNDFVELGKNR*
Ga0117912_1038520Ga0117912_10385205F085858DIKEFNEVVKCKTIPTTFVFRCTLCGFEMTNYDRHLGLIKMNEHIVSNHSTEVNSLGREDLYSRKMEIELDSF*
Ga0117912_1072651Ga0117912_10726511F037999WKAVEAFIRRENDEGRDALIEGVAVLPELMSQLEDIPHRVVFIGNQGENHKENIKKSAEENEHDWMRDVSDQYIGAFAMFVKRMSAYIEQEAKKYGFEYIEMDKELFGDVTEEVMKSLGLSAR*
Ga0117912_1086977Ga0117912_10869771F083361VNVQIDLSGCTLSIENQAVVDAINKFLVLLPDDADHKAALRLAMVILEAADVAPQADLARAADFAQSRSLRDYKQRLREEGLSGLWDHPIPGRPAITTRTPVEKALFQVILSAVIEEHALPDDVTLADRVNQALSEAQVPEAGRVTAPMVETIRLRWEIRRPTLTQQLQATRQPVAAETDLARLGQTRVGGAFILAMLLVETGWLKLAHLLPMAANYAVTATQWLLTAIFAVIYGVRRAFHLDDVRDIGFALLTGRPRPLTHGTFQHLLRAIPAEDAEKFYQASAHLEVQALGEGTRRISLDGHNLPRYTRVVDLVKGKIGNTGRVLKAEELVLAYDLDGHLWLGL
Ga0117912_1104141Ga0117912_11041411F060598GHLWLGLRAYHGTKKLSKGLVEIVRELLNHRGSLKGLLRLFFDKGGYSGQIFLALSEESQVHFYTPAVRYPNNVAQWEQLQESDFDADTFVFDKHADLPVEQRPVYRLADTEMTINVRERNKVVGTVTHRAVELHDPQGEKPAERWPIVLLTDDYEIDARALLNEFGDHWGQEVAHRIGKHDLHLDILPPGYILKTRRDDQGQLHREVEYDQTAFFLSAWLRCLVFNLMSRFAQAMGGEYIKMWAGTLLRKFIRRPATLYLVGKELHVVFDPFPDQDELQPLLDELNAKRTALPWLNNLVVQLSIAQDEPLHPLTEHEKRNRLFGDG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.