3300009299: T14 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times DE NOVO (2)

Overview

Basic Information

• IMG/M Taxon OID: 3300009299
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117429 | Gp0125107 | Ga0115982
• Sample Name: T14 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times DE NOVO (2)
• Sequencing Status: Permanent Draft
• Sequencing Center: Shell Corporation
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 128598756
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea	1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater river biome → river → sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Sediment (non-saline)

Location Information

• Location: UK (Newcastle upon Tyne)
• Coordinates
  • Lat. (^o): 54.971158
  • Long. (^o): -1.703654
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064732	Metagenome / Metatranscriptome	128	Y
F092111	Metagenome / Metatranscriptome	107	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0115982_1003890	All Organisms → cellular organisms → Archaea	1724
Ga0115982_1075887	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.	525

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0115982_1003890	Ga0115982_10038901	F064732	AEAALAAAPERCTMPPAQSAERHVKFPSSPMDPGPYIAAIATRSISPQDPPVHPGHPEDTNYLIVI*
Ga0115982_1075887	Ga0115982_10758872	F092111	VTPEKEEGSDVREMVWEMSRTTNKILIFGIILILAILAVLMYCGVITFPSLPNLV