NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008876

3300008876: Microbial communities of Wadden Sea tidal flat in Germany - 1650 earlyLowTide



Overview

Basic Information
IMG/M Taxon OID3300008876 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117938 | Gp0125978 | Ga0103389
Sample NameMicrobial communities of Wadden Sea tidal flat in Germany - 1650 earlyLowTide
Sequencing StatusPermanent Draft
Sequencing CenterBielefeld University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size26481292
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus aporus1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Of Wadden Sea Tidal Flat In Germany
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Tidal Flat → Microbial Communities Of Wadden Sea Tidal Flat In Germany

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationWadden Sea, Germany
CoordinatesLat. (o)53.73Long. (o)7.67Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017955Metagenome / Metatranscriptome237Y
F054544Metagenome / Metatranscriptome139Y
F056298Metagenome / Metatranscriptome137Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103389_100684Not Available1112Open in IMG/M
Ga0103389_101301All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus aporus892Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103389_100684Ga0103389_1006842F054544ITQVYDNGTVKLVKVTGNGGAVYQTWNIRNIEPRKA*
Ga0103389_101301Ga0103389_1013011F017955MLNASFEADWQFIRERKQRLIVQNNKRENAKRAPHTYNVGDTVVVKAGMQSKHGHAPYLGPMRITQVYDNGTVKLIKVADNNGGAVSQTWNIRNIEPRKA*
Ga0103389_105982Ga0103389_1059821F056298DFSFAGQPSNNSTDPERMRINDYMGLHGETGYLLVYDHATERLEGVCKQSKAPPVAWLRRWLRKNVDKDVKNRYVFMDQGGELYKSKAIRDLFEKEFDYDIRVTGTAAHHQNGLVKWANQTVYKAIRALLIGAGLEVKFWPYAFYHFLASVQLLKS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.