Metagenome / Metatranscriptome Family F054544

Overview

Basic Information

• Family ID: F054544
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 139
• Average Sequence Length: 42 residues
• Representative Sequence: MRITQVCDNGTVKLVKVADNNGGAVSQTWNIRNIEPRMA
• Number of Associated Samples: 22
• Number of Associated Scaffolds: 139

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 7.19 %
• % of genes near scaffold ends (potentially truncated): 87.05 %
• % of genes from short scaffolds (< 2000 bps): 89.21 %
• Associated GOLD sequencing projects: 21
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (91.367 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat (88.489 % of family members)
• Environment Ontology (ENVO): Unclassified (88.489 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Surface (non-saline) (88.489 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 0.00%
  β-sheet: 29.85%
  Coil/Unstructured: 70.15%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 139 Family Scaffolds
PF00665	rve	4.32
PF07727	RVT_2	0.72
PF13391	HNH_2	0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 139 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	4.32
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	4.32
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	4.32
COG4584	Transposase	Mobilome: prophages, transposons [X]	4.32

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
All Organisms	root	All Organisms	8.63 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
cellular organisms	root	All Organisms → cellular organisms	8.63 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	7.91 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.72 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	7.19 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.72 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Stramenopiles	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles	5.76 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.72 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Ochrophyta	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta	5.76 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.72 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Bacillariophyta	phylum	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	5.76 %
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	0.72 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Coscinodiscophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae	2.16 %
Bacillariophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae	2.16 %
Thiohalocapsa	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa	0.72 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Chaetocerotophycidae	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae	2.16 %
Bacillariophycidae	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae	2.16 %
unclassified Thiohalocapsa	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → unclassified Thiohalocapsa	0.72 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Leptocylindrales	order	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales	2.16 %
Naviculales	order	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales	2.16 %
Thiohalocapsa sp. PB-PSB1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → unclassified Thiohalocapsa → Thiohalocapsa sp. PB-PSB1	0.72 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Leptocylindraceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae	2.16 %
Naviculaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae	0.72 %
Amphipleuraceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Amphipleuraceae	0.72 %
Thiohalocapsa sp. PB-PSB1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → unclassified Thiohalocapsa → Thiohalocapsa sp. PB-PSB1	0.72 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Leptocylindrus	genus	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus	2.16 %
Fistulifera	genus	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera	0.72 %
Amphiprora	genus	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Amphipleuraceae → Amphiprora	0.72 %
Thiohalocapsa sp. PB-PSB1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → unclassified Thiohalocapsa → Thiohalocapsa sp. PB-PSB1	0.72 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Leptocylindrus aporus	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus aporus	2.16 %
Amphiprora paludosa	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Amphipleuraceae → Amphiprora → Amphiprora paludosa	0.72 %
Fistulifera solaris	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris	0.72 %
Thiohalocapsa sp. PB-PSB1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → unclassified Thiohalocapsa → Thiohalocapsa sp. PB-PSB1	0.72 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005825|Ga0074476_1181875	Not Available	535
3300005828|Ga0074475_10085211	Not Available	758
3300005828|Ga0074475_10273704	Not Available	774
3300005828|Ga0074475_10834839	Not Available	780
3300008876|Ga0103389_100684	Not Available	1112
3300015360|Ga0163144_10101209	All Organisms → cellular organisms → Eukaryota → Sar	4572
3300015360|Ga0163144_10122254	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	3995
3300015360|Ga0163144_10249556	Not Available	2355
3300015360|Ga0163144_10261533	Not Available	2272
3300015360|Ga0163144_10283681	Not Available	2137
3300015360|Ga0163144_10326561	Not Available	1919
3300015360|Ga0163144_10347559	Not Available	1829
3300015360|Ga0163144_10592302	Not Available	1205
3300015360|Ga0163144_10597289	Not Available	1197
3300015360|Ga0163144_11111286	Not Available	739
3300015360|Ga0163144_11173865	Not Available	709
3300015360|Ga0163144_11200466	Not Available	697
3300015360|Ga0163144_11221195	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus aporus	688
3300015360|Ga0163144_11222014	All Organisms → cellular organisms → Eukaryota → Sar	688
3300015360|Ga0163144_11265223	Not Available	670
3300015360|Ga0163144_11328267	Not Available	646
3300015360|Ga0163144_11389497	Not Available	626
3300015360|Ga0163144_11466810	Not Available	602
3300015360|Ga0163144_11498079	Not Available	593
3300015360|Ga0163144_11643398	Not Available	555
3300015360|Ga0163144_11711745	Not Available	538
3300015360|Ga0163144_11752813	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → unclassified Thiohalocapsa → Thiohalocapsa sp. PB-PSB1	528
3300015360|Ga0163144_11792169	Not Available	519
3300020057|Ga0163151_10057905	Not Available	2746
3300020057|Ga0163151_10152863	Not Available	1417
3300020057|Ga0163151_10192142	Not Available	1204
3300020057|Ga0163151_10262347	Not Available	961
3300020057|Ga0163151_10455850	Not Available	632
3300020057|Ga0163151_10467243	Not Available	620
3300020057|Ga0163151_10532086	Not Available	559
3300020057|Ga0163151_10554485	Not Available	541
3300020192|Ga0163147_10118220	Not Available	1710
3300020192|Ga0163147_10286025	Not Available	887
3300020192|Ga0163147_10314314	Not Available	826
3300020192|Ga0163147_10319038	Not Available	816
3300020192|Ga0163147_10326758	Not Available	801
3300020192|Ga0163147_10376312	Not Available	719
3300020192|Ga0163147_10418884	Not Available	661
3300020192|Ga0163147_10463929	Not Available	610
3300020192|Ga0163147_10498733	Not Available	575
3300020192|Ga0163147_10512693	Not Available	563
3300020192|Ga0163147_10575940	Not Available	512
3300020201|Ga0163154_10241049	Not Available	912
3300020201|Ga0163154_10242119	Not Available	909
3300020201|Ga0163154_10256847	Not Available	870
3300020201|Ga0163154_10262347	Not Available	856
3300020201|Ga0163154_10304138	Not Available	765
3300020201|Ga0163154_10309692	Not Available	755
3300020201|Ga0163154_10334221	Not Available	713
3300020201|Ga0163154_10413212	Not Available	608
3300020201|Ga0163154_10444604	Not Available	574
3300020201|Ga0163154_10452997	Not Available	566
3300020201|Ga0163154_10460771	Not Available	559
3300020203|Ga0163148_10023475	Not Available	4841
3300020203|Ga0163148_10024100	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris	4764
3300020203|Ga0163148_10028040	Not Available	4332
3300020203|Ga0163148_10059067	Not Available	2671
3300020203|Ga0163148_10105181	Not Available	1793
3300020203|Ga0163148_10118581	Not Available	1646
3300020203|Ga0163148_10132190	Not Available	1521
3300020203|Ga0163148_10144304	Not Available	1427
3300020203|Ga0163148_10159378	Not Available	1327
3300020203|Ga0163148_10188864	Not Available	1171
3300020203|Ga0163148_10233347	Not Available	1000
3300020203|Ga0163148_10245208	Not Available	963
3300020203|Ga0163148_10251758	Not Available	944
3300020203|Ga0163148_10266397	Not Available	906
3300020203|Ga0163148_10279147	Not Available	874
3300020203|Ga0163148_10303818	Not Available	820
3300020203|Ga0163148_10345169	Not Available	743
3300020203|Ga0163148_10346050	Not Available	742
3300020203|Ga0163148_10351877	Not Available	732
3300020203|Ga0163148_10355120	Not Available	727
3300020203|Ga0163148_10373173	Not Available	700
3300020203|Ga0163148_10381589	Not Available	688
3300020203|Ga0163148_10414939	Not Available	645
3300020203|Ga0163148_10419070	Not Available	641
3300020203|Ga0163148_10486919	Not Available	569
3300020203|Ga0163148_10552266	Not Available	515
3300020219|Ga0163146_10057907	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales	2888
3300020219|Ga0163146_10148607	Not Available	1549
3300020219|Ga0163146_10176523	Not Available	1374
3300020219|Ga0163146_10240298	Not Available	1105
3300020219|Ga0163146_10260658	Not Available	1042
3300020219|Ga0163146_10386485	Not Available	778
3300020219|Ga0163146_10425275	Not Available	724
3300020219|Ga0163146_10438906	Not Available	707
3300020219|Ga0163146_10445773	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus aporus	699
3300020219|Ga0163146_10458524	Not Available	684
3300020219|Ga0163146_10476872	Not Available	664
3300020219|Ga0163146_10499901	Not Available	641
3300020219|Ga0163146_10511499	Not Available	629
3300020219|Ga0163146_10528649	Not Available	613
3300020219|Ga0163146_10530963	Not Available	611
3300020219|Ga0163146_10642760	Not Available	526
3300020219|Ga0163146_10646196	Not Available	524
3300020596|Ga0163149_10039405	Not Available	3771
3300020596|Ga0163149_10061370	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	2826
3300020596|Ga0163149_10073612	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Amphipleuraceae → Amphiprora → Amphiprora paludosa	2510
3300020596|Ga0163149_10088044	Not Available	2224
3300020596|Ga0163149_10111022	Not Available	1899
3300020596|Ga0163149_10125537	Not Available	1745
3300020596|Ga0163149_10139188	Not Available	1623
3300020596|Ga0163149_10171835	Not Available	1395
3300020596|Ga0163149_10206627	Not Available	1217
3300020596|Ga0163149_10226605	All Organisms → cellular organisms → Eukaryota	1136
3300020596|Ga0163149_10229291	Not Available	1126
3300020596|Ga0163149_10269439	Not Available	996
3300020596|Ga0163149_10279891	Not Available	967
3300020596|Ga0163149_10313031	Not Available	886
3300020596|Ga0163149_10329577	Not Available	851
3300020596|Ga0163149_10424215	Not Available	694
3300020596|Ga0163149_10454338	Not Available	656
3300020596|Ga0163149_10457497	Not Available	653
3300020596|Ga0163149_10458341	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus aporus	652
3300020596|Ga0163149_10514865	Not Available	591
3300020596|Ga0163149_10532783	Not Available	574
3300020596|Ga0163149_10538197	Not Available	569
3300020596|Ga0163149_10594454	Not Available	524
3300020596|Ga0163149_10594578	Not Available	523
3300020596|Ga0163149_10601322	Not Available	518
3300020596|Ga0163149_10604032	Not Available	516
3300021267|Ga0210353_123146	Not Available	568
3300021298|Ga0210349_1054026	Not Available	1156
3300021313|Ga0210333_1346283	Not Available	508
3300021316|Ga0210351_1083164	Not Available	630
3300021331|Ga0210347_1364609	Not Available	530
3300021346|Ga0210335_1482185	Not Available	827
3300021848|Ga0210368_119052	Not Available	740
3300022222|Ga0226658_10283315	Not Available	748
3300022364|Ga0210367_103275	Not Available	521
3300022373|Ga0210319_1035226	Not Available	500
3300026477|Ga0256807_1046052	Not Available	731
3300032136|Ga0316201_11784422	Not Available	507

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	100.00%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	89.21%
Marine	Environmental → Aquatic → Marine	7.91%
Sediment	Environmental → Aquatic → Sediment	2.88%

Type

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	88.49%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	6.47%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.88%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.72%
Coastal	Environmental → Aquatic → Marine → Coastal	0.72%
Unclassified	Environmental → Aquatic → Marine → Unclassified	0.72%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	88.49%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	6.47%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.88%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.72%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment	0.72%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	0.72%

Habitat

Habitat	Taxonomy	Distribution
Freshwater Microbial Mat	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat	88.49%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	6.47%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	2.88%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.72%
Worm Burrow	Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow	0.72%
Tidal Flat	Environmental → Aquatic → Marine → Unclassified → Unclassified → Tidal Flat	0.72%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005825	Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB	Environmental
3300005828	Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI	Environmental
3300008876	Microbial communities of Wadden Sea tidal flat in Germany - 1650 earlyLowTide	Environmental
3300015360	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1	Environmental
3300020057	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2	Environmental
3300020192	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1	Environmental
3300020201	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP9.P1	Environmental
3300020203	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP7.P2	Environmental
3300020219	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP7.G1	Environmental
3300020596	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1	Environmental
3300021267	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.489 (Metagenome Metatranscriptome)	Environmental
3300021298	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.460 (Metagenome Metatranscriptome)	Environmental
3300021313	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.304 (Metagenome Metatranscriptome)	Environmental
3300021316	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.485 (Metagenome Metatranscriptome)	Environmental
3300021331	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.456 (Metagenome Metatranscriptome)	Environmental
3300021346	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.374 (Metagenome Metatranscriptome)	Environmental
3300021848	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.667 (Metagenome Metatranscriptome)	Environmental
3300022222	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2)	Environmental
3300022364	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.665 (Metagenome Metatranscriptome)	Environmental
3300022373	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.180 (Metagenome Metatranscriptome)	Environmental
3300026477	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR5	Environmental
3300032136	Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0074476_11818751	3300005825	Sediment (Intertidal)	MRITQVNDNGTVKLVKVADNNGGAVSQTWNIRNIEPRMA*
Ga0074475_100852111	3300005828	Sediment (Intertidal)	PTYRVTHVYDNGTVRLEKVANNNGGAVSETWNIRNIEPRKA*
Ga0074475_102737042	3300005828	Sediment (Intertidal)	ITHVYDNGTVRLVKVADNGGAVSQTWNIRNIEPRKD*
Ga0074475_108348392	3300005828	Sediment (Intertidal)	RITQVHDNGTVKLIKVSDENGGAVTQTWNIRNIQPGMA*
Ga0103389_1006842	3300008876	Tidal Flat	ITQVYDNGTVKLVKVTGNGGAVYQTWNIRNIEPRKA*
Ga0163144_101012097	3300015360	Freshwater Microbial Mat	PHLDPMRIAQVCDNGTVKLVKVADNNGGAVSQTWNIRNIEPRVA*
Ga0163144_101222541	3300015360	Freshwater Microbial Mat	QVNDNGTVKLVKVTDNNGGAVSQTWNIRNIEPRMA*
Ga0163144_102495561	3300015360	Freshwater Microbial Mat	ISISNTYLDPMRITQVNDNGTVKLVKVANNGRAVSQTWNIRNIEPRMA*
Ga0163144_102615331	3300015360	Freshwater Microbial Mat	TQVCDNGTVKLVKVADNNGRAVSQTWNILNIEPHMA*
Ga0163144_102836811	3300015360	Freshwater Microbial Mat	KHGSNPYLDPMRIAQVNDNGTVKLVKVTDNNGGVVSQTWNIRNIEPHMA*
Ga0163144_103265612	3300015360	Freshwater Microbial Mat	GPMRITQVHDNGTVKLVKVADNNGGAVSRTWNIRNVEPRMA*
Ga0163144_103475591	3300015360	Freshwater Microbial Mat	TQVNDNGTVKLVKVTDNNGGAVSQTWNIRNIEPRMA*
Ga0163144_105923021	3300015360	Freshwater Microbial Mat	TQVYDNGTVKLEKVADNGGAVSQTWNIRNIEPRMA*
Ga0163144_105972891	3300015360	Freshwater Microbial Mat	IAQAHDGTVKLVKVADNNGGAVSQTWNIRNVEPRMA*
Ga0163144_111112862	3300015360	Freshwater Microbial Mat	LDPMRITQACDNGTVKLVKVVDNNGGAVSQTWNIRNIEPRMA*
Ga0163144_111738652	3300015360	Freshwater Microbial Mat	RKHGSNPCLDPMRIAQACDNGAVKLVKVADNNSRAVSQTWNIRNIELRMA*
Ga0163144_112004663	3300015360	Freshwater Microbial Mat	MRIAQVNDNGTVKLVKVADNKGGAVSQTWNIRNVEPRMA*
Ga0163144_112211951	3300015360	Freshwater Microbial Mat	MRITQAYDNGTVKLVKVADNNGGAVSQTWNIQNIEPRMA
Ga0163144_112220142	3300015360	Freshwater Microbial Mat	MRIAQVRDNGAVKLVKVADNNGGAVSQTWKIRNIEPRMA*
Ga0163144_112652231	3300015360	Freshwater Microbial Mat	MRITQAYDNGAVKLEKVADNGGAVSQTWNIRNVEPRMA*
Ga0163144_113282671	3300015360	Freshwater Microbial Mat	RITQPCDNGTVKLVKVADDNGGAVSQTWNILNIEPRIT*
Ga0163144_113894971	3300015360	Freshwater Microbial Mat	KHGSNPYLDPMRITQVYDNGTVKLVKVADNNGGAVTQTWNIRNIEPRMA*
Ga0163144_114668101	3300015360	Freshwater Microbial Mat	MAQIQACLDPMRITQAYDNGTVKLVKVADNNSGAVSQTWIVRNVEPRIA*
Ga0163144_114980791	3300015360	Freshwater Microbial Mat	RITQACDNGTVKLIKVAKNNSGAVSQTWNIRNVEPLMS*
Ga0163144_116433981	3300015360	Freshwater Microbial Mat	QACDNGTVKLVKVAENNGGAVSQTWNIRNIEPRMA*
Ga0163144_117117452	3300015360	Freshwater Microbial Mat	LDPMRITQACDNGTVKLVKVANNNGGEVSQTWNIRDVEPCMA*
Ga0163144_117528132	3300015360	Freshwater Microbial Mat	MRIAQACDNGAVKLVKVADNNGGAVSQTWNIRNIEPRMA
Ga0163144_117921692	3300015360	Freshwater Microbial Mat	PMRITQVHDNGTVKLVKVANNNGGAVSQTWNIRNVEPRMA*
Ga0163151_100579051	3300020057	Freshwater Microbial Mat	HLDPMRITQAHDNGTVKLVKVADNNGGAVSKTWNIRNVEPRMA
Ga0163151_101528631	3300020057	Freshwater Microbial Mat	SNPYLDPMRITQANDNGTVKLIKVANNGGTVSQTWNIRNIEPRMA
Ga0163151_101921421	3300020057	Freshwater Microbial Mat	SNPYLNPMRITQVNDNSTVKLVKVADNNGGAVSQTWNIRNIEPRIA
Ga0163151_102623471	3300020057	Freshwater Microbial Mat	LDPMRIAQANDNGTVKLVTVADNNGGAVSQTWNIWNVEPRMA
Ga0163151_104558502	3300020057	Freshwater Microbial Mat	MRITQPCDNGTVKLVKVADDNGGAVSQTWNILNIEPRIT
Ga0163151_104672431	3300020057	Freshwater Microbial Mat	TQACDNGTVKLTKVADDGGAVSQTWNIRNVEPRMA
Ga0163151_105320861	3300020057	Freshwater Microbial Mat	THPYLGPTRITQVYDNGTVKFEKVADNGGAVSQTWNIRNIEPRMA
Ga0163151_105544851	3300020057	Freshwater Microbial Mat	SCPHLDPMRTAKVHDNGTVKLVKVADNDGGAVSQTWNIWNVELRIA
Ga0163147_101182201	3300020192	Freshwater Microbial Mat	MKAFDRQPCLGPMRITQVYDNGTVKLTKVADNGGAVSQTWNIRNVEPRMA
Ga0163147_102860252	3300020192	Freshwater Microbial Mat	PYLNPMRITQVNDNGTVKLVKVADNNGRAVSQTWNIWNVEPRMA
Ga0163147_103143141	3300020192	Freshwater Microbial Mat	MRIAQVCDNGTVKLAKVAENNSGVVSQTWNIRNVEPRMA
Ga0163147_103190381	3300020192	Freshwater Microbial Mat	ITQVCDNGTVKLVKVADNNGGAVSQTWNIRNIEPRMA
Ga0163147_103267582	3300020192	Freshwater Microbial Mat	SNPYLDPMRIRQVYNNGTVKLVKVTDNNGGAVSQTWNIRNIEPRMA
Ga0163147_103763122	3300020192	Freshwater Microbial Mat	HGLNPHLDPMRITQACDNGTVKLVKVVDNNGGAVSQTWNIRNIEPRMA
Ga0163147_104188841	3300020192	Freshwater Microbial Mat	PHLDPMGITQASDNGTVKLVKVVNNGGAVSQTWNIRNIEPHMT
Ga0163147_104639291	3300020192	Freshwater Microbial Mat	QAGDNGTVKLVKVADDNGGAVSQTWNIRNVEPRMA
Ga0163147_104987331	3300020192	Freshwater Microbial Mat	SNPYLGPMRITQVHDNGTVKLVKVADNNGGAVSQNWNIRNIEPRMA
Ga0163147_105126931	3300020192	Freshwater Microbial Mat	MRIAQAHDNGTVMLVKVADNNSGVVSQTWNIRSVEQRIA
Ga0163147_105759401	3300020192	Freshwater Microbial Mat	MRITQVYDNGTVKLVKVADNNSGAVSQTWNIRNIEPRMA
Ga0163154_102410491	3300020201	Freshwater Microbial Mat	MRITQVYDNGTVKLVKVADNNGGAVSQTWNIRNIEPRMA
Ga0163154_102421191	3300020201	Freshwater Microbial Mat	HPYLGPMRITQVYDNGAVKLEKVADNGGAVSQTWNIRNVEPRMA
Ga0163154_102568471	3300020201	Freshwater Microbial Mat	MRIAQVNDNGTVKLVKVADNKGGAVSQTWNIRNVEPRMA
Ga0163154_102623471	3300020201	Freshwater Microbial Mat	GSNPHLDPMRITQVCDNGTVKLVKVADNNGRAVSQTWNIRNIEPRMA
Ga0163154_103041381	3300020201	Freshwater Microbial Mat	PYLGPMRITQAHDNGTVKLTKVANNGGAVSQTWNIWNIEPRMA
Ga0163154_103096921	3300020201	Freshwater Microbial Mat	VAQACDNGAVKLVKVADNNGGAVSQTWNIRNIEPRMA
Ga0163154_103342211	3300020201	Freshwater Microbial Mat	CLGPMRIAQVHDNGTVKLTKVADNGRAVSETWNIRNVEPRMA
Ga0163154_104132121	3300020201	Freshwater Microbial Mat	QACDNGTVKLVKVTDNNGRAVSQTWNIRNIEPPMA
Ga0163154_104446042	3300020201	Freshwater Microbial Mat	NPHLDPMRITQACDNGTVKLVKVADNNGGAVSQTWNIRNIEPCMA
Ga0163154_104529972	3300020201	Freshwater Microbial Mat	TQACDNGTVKLTKVADNGGAVSQTWNIRNVEPRMA
Ga0163154_104607711	3300020201	Freshwater Microbial Mat	ITQACNNGTVKLVKVADNNGGVVSQTWNIRNVEPRMA
Ga0163148_100234751	3300020203	Freshwater Microbial Mat	PMRITQVFDNGTVKLVKVAENNGGVVSQTWNIRNVEPRMA
Ga0163148_100241006	3300020203	Freshwater Microbial Mat	TQVCDNGTVKLVKVADNNGGAVSQNWNIRNIEPRMA
Ga0163148_100280401	3300020203	Freshwater Microbial Mat	PYLNPIRITQVNDNGTVKLVKVANNNGGAVSQTWNIRNIEPRMA
Ga0163148_100590672	3300020203	Freshwater Microbial Mat	ITQVCDNGTVKLAKVADDNGGAVSQTWNIRNIEPLMA
Ga0163148_101051812	3300020203	Freshwater Microbial Mat	HLGPMRIAQACDNGTVKLVKVADNNGGAASQTWNVRNIEPRMA
Ga0163148_101185811	3300020203	Freshwater Microbial Mat	ITQVCDNGTVKLVKVADNNGGAVSQTWNIRNIEPCMA
Ga0163148_101321901	3300020203	Freshwater Microbial Mat	ITQAYDNGTVKLVKVADNNGGAVSQTWNIRNVEPRMA
Ga0163148_101443041	3300020203	Freshwater Microbial Mat	PMRITQAYDNGTVKLAKVADNNGGAVSQTWNIRNIEPRMA
Ga0163148_101593781	3300020203	Freshwater Microbial Mat	MRITQVYDNGAVKLEKVTDNGGAVSQTWNIRNVEPHMA
Ga0163148_101888641	3300020203	Freshwater Microbial Mat	PMGITQVNDNGTVKLFKVANNGGAVSQTWNIQNVKPRMA
Ga0163148_102333472	3300020203	Freshwater Microbial Mat	GRKHGSNPCLDSMRITQVHDNGTVKHVKVADNDGGAVFQTWNVRNVEPRMA
Ga0163148_102452082	3300020203	Freshwater Microbial Mat	TQVCDNGTVKLVKVADDNGGAVSQTWNIKNIEPRMA
Ga0163148_102517582	3300020203	Freshwater Microbial Mat	MRIAQVHDSGAVKLVKVADNNGGAVSQTWNTRNVEPRAA
Ga0163148_102663971	3300020203	Freshwater Microbial Mat	SNPCLDPMRIAQACDNGAVKLVKVADNNSRAVSQTWNIRNIELRMA
Ga0163148_102791471	3300020203	Freshwater Microbial Mat	NPHLDPMRIAQARDNGAVKLVKVADDNGGAVSQAWNIRNLEPRMA
Ga0163148_103038183	3300020203	Freshwater Microbial Mat	MRIAQAFDNGTVKLVKVAENNGGAVSQTWNIRNIEPRMA
Ga0163148_103451691	3300020203	Freshwater Microbial Mat	KHGTHPYLGPMRITQVYDNGTVKLEKVADNGGAVSQTWNIRNIEPRMA
Ga0163148_103460502	3300020203	Freshwater Microbial Mat	MRIAQVHDNGTVKLVKVAENKGGAVSQTWNIRNVEPRMA
Ga0163148_103518771	3300020203	Freshwater Microbial Mat	TQVYDNGTVKLVKVADNNGGAVSQTWNIRNIEPRMA
Ga0163148_103551201	3300020203	Freshwater Microbial Mat	VGPMRITQACDNGTVKLVKVAENNGGAVSQTWNIRNIEPRMA
Ga0163148_103731731	3300020203	Freshwater Microbial Mat	HGSNPHLGPMRIAQACDNGTVKLVKVADNNGGAVSQTWNIRNVEPRMA
Ga0163148_103815891	3300020203	Freshwater Microbial Mat	HLGPMRIAQAHDNGTVKLVKVADNNGGAVSQTWNIRSVEPHMA
Ga0163148_104149391	3300020203	Freshwater Microbial Mat	VSPMRITQAYDNGTVKLVKVADNNGGAVSQTWNTRNVEPRMA
Ga0163148_104190701	3300020203	Freshwater Microbial Mat	TQACDNGTVKLVKVANNNGGAVSQTWNIRNVEPRMA
Ga0163148_104869191	3300020203	Freshwater Microbial Mat	RKHGSNPHLGPMRIAQACDNGTVKLAKFADDNGGAVSQTWNIRNVEPRMA
Ga0163148_105522661	3300020203	Freshwater Microbial Mat	SNPHFGPMRITQACDNGTVKLVKVAENNGGAVSHAWNIRNVEPRMA
Ga0163146_100579077	3300020219	Freshwater Microbial Mat	PYLDPMRITQVYDNGTVKLVKVANNNGGAVSQTWNIRNIEPHMA
Ga0163146_101486071	3300020219	Freshwater Microbial Mat	KHGSNPHLGPMRIAQVCDNGTVKLVKVADNNGGAVSQTWNIRNVEPRMA
Ga0163146_101765232	3300020219	Freshwater Microbial Mat	MRIAQACDNGTVKLVKVADDNGGAVSQTWNIRNVEPRMA
Ga0163146_102402982	3300020219	Freshwater Microbial Mat	RIAQAFDNGAAKLVKVADNNGGAVSQTWNIRSVEPRMA
Ga0163146_102606583	3300020219	Freshwater Microbial Mat	HGSNPHLDPMRIAQANDNGAVKLVKVADNNGGAVSQTWNIQNVELRMA
Ga0163146_103864851	3300020219	Freshwater Microbial Mat	AQVHDNGTVKLVKVAENNGGAVSQTWNIRNIEPCMA
Ga0163146_104252751	3300020219	Freshwater Microbial Mat	GRKHGSNPCLGPMRIAQVCDNGTVKLVKVAEHNGGAVSQTWNIRNVEPRMA
Ga0163146_104389061	3300020219	Freshwater Microbial Mat	RTTQACDNGTVNLTKVADNGGAVSQTWNIRNVEPRMA
Ga0163146_104457732	3300020219	Freshwater Microbial Mat	VYDNGTVKLVKVADNNGGAVSQTWNIRNIEPRMAXSPMCNY
Ga0163146_104585241	3300020219	Freshwater Microbial Mat	NPHLGPMRIAQVCDNGTVKLVKVADNNGGAVSQTWNIRNIEPRMA
Ga0163146_104768721	3300020219	Freshwater Microbial Mat	PCLDPMRIAQVCDNGTVKLVKVADDNGGAVSQTWNIRKPRMA
Ga0163146_104999012	3300020219	Freshwater Microbial Mat	NPCLGPMRITQAHDNGTVKLVKVADNNGGAVSQTWNIRNVEPRMA
Ga0163146_105114991	3300020219	Freshwater Microbial Mat	RKHGSTPHLDPMRIAQVCDNGTVKLVKVADNNGGAVSQTWNIRNIEPRVA
Ga0163146_105286492	3300020219	Freshwater Microbial Mat	MRIAQVCDNGAAKLVKVADNNGGAVSQTWNIRNVEPRMA
Ga0163146_105309631	3300020219	Freshwater Microbial Mat	ITQVYDNGTVKLVKVADNNGGAVSQTWNIRNIEPRMT
Ga0163146_106427601	3300020219	Freshwater Microbial Mat	HLGPMRIAQACDNGTVKLVKVADNNGGAVSQTWNIRNIELRMT
Ga0163146_106461961	3300020219	Freshwater Microbial Mat	MRIAQTHDNGTVKLVKVADDNGGAVSQTWNIRNIELRMA
Ga0163149_100394052	3300020596	Freshwater Microbial Mat	PMRITQAYDNGTVKLVKVADNNGGAVSQTWNIRNVEPRMA
Ga0163149_100613701	3300020596	Freshwater Microbial Mat	KHKHGSNPCLGPMRITQVCDNGTVKLVKVAENNGGALSQTWNIRNIEPSMA
Ga0163149_100736124	3300020596	Freshwater Microbial Mat	NPYLNPRRITQVNDNGTVKLIKVADNNGGAVFQTWNIQNIELRMA
Ga0163149_100880441	3300020596	Freshwater Microbial Mat	PCLGPMRITQAYDNGAVKLEKVADNGGAVSQTWNIRNVEPRMA
Ga0163149_101110222	3300020596	Freshwater Microbial Mat	HLGPMRITQVYDNGTVKLVKVADNNGGAVSQTWNIRNIEPRMA
Ga0163149_101255371	3300020596	Freshwater Microbial Mat	RIAQAYDNGTVKLVKVADNNGGAVSQTWNIRNVEPCMA
Ga0163149_101391883	3300020596	Freshwater Microbial Mat	SNPCLGPMRITQACDNGTVKLIKVADNNGGAVSQTWNIRNVEPRMA
Ga0163149_101718351	3300020596	Freshwater Microbial Mat	SSPHLGPMRIAQACDNDTVKLVKVTDNSGGAVSQTWNIRNVEPRMA
Ga0163149_102066271	3300020596	Freshwater Microbial Mat	PMRITQVNDNSTVKLVKVADNNGGAVSQTWNIRNIEPRIA
Ga0163149_102266051	3300020596	Freshwater Microbial Mat	HGSNPHLGPMRITQACDNGTVKLVKVAKNNGGAVSQTWNIRNVEPRMA
Ga0163149_102292913	3300020596	Freshwater Microbial Mat	PCLGPMRITQVHDNGTVKLVKVAGNNGGAVSQTWNIRNVEPRMA
Ga0163149_102694391	3300020596	Freshwater Microbial Mat	CLGPMRTTQVCDNGTVKLTKVADNGGAVSQTWNIRNIEPRMA
Ga0163149_102798911	3300020596	Freshwater Microbial Mat	RKHGSNPCLDPMRIAQVYDNGTVKLVKVADNNGGAVSQTWNIWNIERCMA
Ga0163149_103130311	3300020596	Freshwater Microbial Mat	YLGPMRITQVYDNGAVKLEKVADNGGAVSQTWNIRNVEPRMA
Ga0163149_103295771	3300020596	Freshwater Microbial Mat	LGPMRIAQAHDNGTVKLVKVADNNGGAVSQTWNIRNIEPRMA
Ga0163149_104242151	3300020596	Freshwater Microbial Mat	SNPYLGPMRIAQACNNGTVKLVKVAENNGGAVSQTWNIRNIEPRMA
Ga0163149_104543381	3300020596	Freshwater Microbial Mat	PYLGPMRITQACDNGTVKLVKVAKNNGGAVSQTWNIRNIEPRMA
Ga0163149_104574971	3300020596	Freshwater Microbial Mat	GSNPHLDPMKITQANDNGTVKLINVANNGRAVSQTWNIRNIEPRMT
Ga0163149_104583411	3300020596	Freshwater Microbial Mat	MRITQVHDNGTVKLVKVADNNGRAVSQTWNIRNIEPHMA
Ga0163149_105148651	3300020596	Freshwater Microbial Mat	MAQIQACLDPMRITQAYDNGTVKLVKVADNNSGAVSQTWIVRNVEPRIA
Ga0163149_105327831	3300020596	Freshwater Microbial Mat	HGSNPCLGPMRITQACDNGTVKLVKVADNNGGAVSQTWNVEPRMA
Ga0163149_105381971	3300020596	Freshwater Microbial Mat	MRITQVYDNGTVKLVKVADNNGGAVSQTWHIRNIEPRMA
Ga0163149_105944541	3300020596	Freshwater Microbial Mat	HGSNPYLDPMRITQVYDNSTVKLVKVADNNGEAVSQTWNIRNIEPRMA
Ga0163149_105945781	3300020596	Freshwater Microbial Mat	NPHLDPMRIAQAYDNGTVKLVKVADNNGGAVSQTWNIRNVEPCMA
Ga0163149_106013221	3300020596	Freshwater Microbial Mat	AGKGRKHGSNPCLGPMRITQACDNGTVKLVKVADNNGGAVSQTWNIRNIEPRMA
Ga0163149_106040321	3300020596	Freshwater Microbial Mat	HGSNPHLGPMRITQACDNGTVKLVKVAENNGGAVSQTWNIRNIEPRMA
Ga0210353_1231461	3300021267	Estuarine	MRITQVCDNGTVKLVKVADNNGGAVSQTWNIRNIEPRMA
Ga0210349_10540262	3300021298	Estuarine	NPYLDPMRITQVNDNGTVKLVKVADNNGGAVSQTWNIRNIEPRMA
Ga0210333_13462831	3300021313	Estuarine	VTHVYDNGTVRLEKVANNNGGAVSETWNIRNIEPRKA
Ga0210351_10831641	3300021316	Estuarine	MRTTQTNDNGTVKLVKVANNNGGAVSQTWNIRNIEPRMA
Ga0210347_13646091	3300021331	Estuarine	YLDPMRITQVNDKGTVKLVKVADNNDGAVSQTWNIRNIEPRMA
Ga0210335_14821851	3300021346	Estuarine	VGPQRITHVYDNGTVRLVKVADNGGAVSQIWNIRNIEPRKA
Ga0210368_1190521	3300021848	Estuarine	LDPMRITHVYDNGTVRLVKVANNGGAVSQTWNIRNIEPRKA
Ga0226658_102833151	3300022222	Freshwater Microbial Mat	MRIAQVRDNGAVKLVKVADNNGGAVSQTWKIRNIEPRMA
Ga0210367_1032751	3300022364	Estuarine	SNPHLGPMRIAQACDNGTVKLVKVAENNGGAVSQTWNIRNVEPRMA
Ga0210319_10352261	3300022373	Estuarine	PHLDPMRITQVNDNGTVKLVKVADNNGGVVSQTWNIRNIEPRMA
Ga0256807_10460521	3300026477	Sediment	YAVHQVCDNGTVRLSRVADNGGAVYQTWNIRNVDPCMA
Ga0316201_117844221	3300032136	Worm Burrow	MRITQAHDNGTVKLIKVTNNNGGAVSQTWNIRNIELRKV