3300006882: T10 (2) BES, Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times

Overview

Basic Information

• IMG/M Taxon OID: 3300006882
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117429 | Gp0125657 | Ga0102489
• Sample Name: T10 (2) BES, Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times
• Sequencing Status: Permanent Draft
• Sequencing Center: Shell Corporation
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 42890730
• Sequencing Scaffolds: 4
• Novel Protein Genes: 4
• Associated Families: 4

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.	1
All Organisms → cellular organisms → Archaea	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater river biome → river → sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Sediment (non-saline)

Location Information

• Location: UK (Newcastle upon Tyne)
• Coordinates
  • Lat. (^o): 54.971158
  • Long. (^o): -1.703654
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030486	Metagenome / Metatranscriptome	185	Y
F090409	Metagenome	108	Y
F092111	Metagenome / Metatranscriptome	107	Y
F101218	Metagenome / Metatranscriptome	102	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0102489_104215	Not Available	1506
Ga0102489_106343	Not Available	1158
Ga0102489_110925	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.	800
Ga0102489_114263	All Organisms → cellular organisms → Archaea	669

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0102489_104215	Ga0102489_1042155	F030486	VRRYVALAQSRGGACFCTRGAMQDYAVITLFSRWQKP*
Ga0102489_106343	Ga0102489_1063432	F090409	LARGRSNGGDRVKKEFAGILQTSFGVTDSVHFSLEMPGSLIGDANQFLEGARRKRVLVTIETQEVAD*
Ga0102489_110925	Ga0102489_1109252	F092111	VTPEEEGSDVREMVWEMSRTTNKILIFGIILILAILAALIYLGILTFS*
Ga0102489_114263	Ga0102489_1142632	F101218	SMSRRTSKPALPKIKEPPPLPSIDELIAECRAVGWNDLAKSMEKIRYLDSPEGQKALKGRERRISRL*