NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006825

3300006825: Combined Assembly of Gp0125114, Gp0125115, Gp0125116



Overview

Basic Information
IMG/M Taxon OID3300006825 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117429 | Gp0125114 | Ga0101939
Sample NameCombined Assembly of Gp0125114, Gp0125115, Gp0125116
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size72554893
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Williamwhitmaniaceae → Williamwhitmania → Williamwhitmania taraxaci1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074913Metagenome / Metatranscriptome119Y
F090409Metagenome108Y
F092111Metagenome / Metatranscriptome107Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0101939_107851All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Williamwhitmaniaceae → Williamwhitmania → Williamwhitmania taraxaci1597Open in IMG/M
Ga0101939_127386Not Available644Open in IMG/M
Ga0101939_135331Not Available536Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0101939_107851Ga0101939_1078512F074913MQFSAFVLALLPTFGGMCMLPQHRGGAVFALVVRCRIMMLFVYYRVGKNRDTRRESPAGAGAGRGASHKNRLFSYSIVATGAAIAYTDLFR*
Ga0101939_127386Ga0101939_1273861F090409MKKQFAGTLLTSFGMMGSVHFNLELPGSIIGDTNQFLEEAKGMRVLVTVETEEVMA*
Ga0101939_135331Ga0101939_1353311F092111MTPEEEGSDVREMVWEMSRTTNKILFFGIILILAILAVLMYCGIIAFPSLAVLPLAKSGA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.