| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006825 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117429 | Gp0125114 | Ga0101939 |
| Sample Name | Combined Assembly of Gp0125114, Gp0125115, Gp0125116 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Shell Corporation |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 72554893 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Williamwhitmaniaceae → Williamwhitmania → Williamwhitmania taraxaci | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | UK (Newcastle upon Tyne) | |||||||
| Coordinates | Lat. (o) | 54.971158 | Long. (o) | -1.703654 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F074913 | Metagenome / Metatranscriptome | 119 | Y |
| F090409 | Metagenome | 108 | Y |
| F092111 | Metagenome / Metatranscriptome | 107 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0101939_107851 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Williamwhitmaniaceae → Williamwhitmania → Williamwhitmania taraxaci | 1597 | Open in IMG/M |
| Ga0101939_127386 | Not Available | 644 | Open in IMG/M |
| Ga0101939_135331 | Not Available | 536 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0101939_107851 | Ga0101939_1078512 | F074913 | MQFSAFVLALLPTFGGMCMLPQHRGGAVFALVVRCRIMMLFVYYRVGKNRDTRRESPAGAGAGRGASHKNRLFSYSIVATGAAIAYTDLFR* |
| Ga0101939_127386 | Ga0101939_1273861 | F090409 | MKKQFAGTLLTSFGMMGSVHFNLELPGSIIGDTNQFLEEAKGMRVLVTVETEEVMA* |
| Ga0101939_135331 | Ga0101939_1353311 | F092111 | MTPEEEGSDVREMVWEMSRTTNKILFFGIILILAILAVLMYCGIIAFPSLAVLPLAKSGA |
| ⦗Top⦘ |