NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006716

3300006716: Marine microbial communities from the Deep Atlantic Ocean - MP0441B (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300006716 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054900 | Ga0005502
Sample NameMarine microbial communities from the Deep Atlantic Ocean - MP0441B (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size127700093
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → Viruses → Predicted Viral2
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium PRS21
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)-22.5716Long. (o)-36.5529Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006550Metagenome / Metatranscriptome370N
F006551Metagenome / Metatranscriptome370Y
F024127Metagenome / Metatranscriptome207Y
F051950Metagenome / Metatranscriptome143Y
F065861Metagenome / Metatranscriptome127Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0005502_1000767Not Available559Open in IMG/M
Ga0005502_1004388All Organisms → Viruses → Predicted Viral2193Open in IMG/M
Ga0005502_1021208Not Available590Open in IMG/M
Ga0005502_1224403Not Available632Open in IMG/M
Ga0005502_1290299All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium PRS2541Open in IMG/M
Ga0005502_1298912All Organisms → cellular organisms → Bacteria569Open in IMG/M
Ga0005502_1310839All Organisms → Viruses → Predicted Viral2150Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0005502_1000767Ga0005502_10007671F006551WAANATIDRDSSSDFDCTVESASGTIGTNGVLTDDTLRTFLRKIRIAAGKDPNVFLGSHEVYSEIQGLYMPSVRIPNPYGESLVQIDVNGIQTFKGTGVGIHVDSIYGIPFIPSKDAPSDSGDASEIGRLFAFDTSDAEGYGYPRIGIQIAIPTEYYEATRRSPAYPFVNNAFVEKGVFRTMGET
Ga0005502_1004388Ga0005502_10043883F006550MQAKINKREIDYEGQQLWLNPVDKTVYATDGAPTYSFSEVNGTPIYNYNSHFDAVKTAKDKLGTSYYHDAFVDQEFKSLAEDYVSDVKSGGRQRQAALRSSVNSAVDIVNVWETVLGKRDRVYAAKNLAKEIAVPNLLISIDTVTKFTGMEKLDEGMRARVKELPYTRATFTAAKYGLKFIIHEEARLKNVHNVLQDSIQVASTKIEQRQSFDVIDVVETNTAQAAIAVWDTFVSSTDRSTGDPTIDIGIASLNIEGSGVGGRLNRVGMHQLTFAKFTGNSFLRGVASVGARDYNYEPGTSELVGIPGIGLVLDNGIKQGDVHCVDTELEPNCALFQGPQRVGSQHDEETGDDKYFII
Ga0005502_1021208Ga0005502_10212081F006551TIDRDSGTAFDCTVESASGTIGTNGVLTDDTLRAFLRKIRIAAGKDPNVFLGSHEVYSEIQGLYMPSVRIPNPYGEALVQIDVNGIQSFKGTGVGIHVDSIYGIPFIPSKDAPSSSSDSSEVGRLFAFDTSDAEGYGYPRIGIQIAIPTEYYEATRRSPGYPFVNNAFVEKGVFRTMGETVCRHFRSQGKIRDIKL
Ga0005502_1224403Ga0005502_12244031F051950YISTEASYQLNFNVGFSTTRSDVLVHLAQ*QY***F*FAFL*SFYYFLTARVVRYGSLKMKPKMSTSFRPHGK*GDFIAAIIPAI*CVNILSNSNFILRLIE*QNESSLFTIRVRARQ*Y*VYKFELKNFTDILSAPKNIGYNK*SVNTFGDLQVAEDYLYVLQLRSQNK*VKNY*EEVLQKTEEVKKNHIVAPQEQLRLEILNKSNLNK
Ga0005502_1290299Ga0005502_12902992F065861MGIVIVIRRKISLIYRKNSFIFNPPLRVVLFMIRGEIIGCNNISAAIPTLEEGLLHKNKLVLNCLT*
Ga0005502_1298912Ga0005502_12989121F024127MIYKLTPKKSRDVKTLIEAETEKAAILYFAALLNLSADDLLQIYKIR*
Ga0005502_1310839Ga0005502_13108393F006550MTRIFNEKKADYNGMQLWLNPVDKTVYATDGKPTYSFHEAGGYPIYDFNAHFKGQKLAKDNFGNGAYQQDAFIDSEFKNLTEEYVSDVKAGGRQRTAALRSNTNAAVDIVNVWETVLGKQDRTYAGKNLAKEIAVPNLLISIDTATKFSGMTQLDEGQLGQLKELTYTRSTFEANKYGLKFVIHEEARLKNVHNVLQDSIQVASNKVEQRQSFDVVTLADASLTAKAAIGVWDTFVASADRSTNNPLLDLGIVQLLIEGSGVGGKLSRIGMHPLDFAKYTGNTFIRGVASTKPSEVTFEPGTRELPGFPNAGLVLDNAIRQGDVYCVDTEKEPTIALFQGPQRIGSAHDEETGDDKYFIIDYHLASIIQSETGRQITGISTP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.