3300006653: Combined Assembly of Gp0123708, Gp0123962, Gp0123963

Overview

Basic Information

• IMG/M Taxon OID: 3300006653
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117429 | Gp0123708 | Ga0101727
• Sample Name: Combined Assembly of Gp0123708, Gp0123962, Gp0123963
• Sequencing Status: Permanent Draft
• Sequencing Center: Shell Corporation
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 62409315
• Sequencing Scaffolds: 4
• Novel Protein Genes: 4
• Associated Families: 4

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1
Not Available	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Sediment (non-saline)

Location Information

• Location: UK
• Coordinates
  • Lat. (^o): 54.971158
  • Long. (^o): -1.703654
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020363	Metagenome / Metatranscriptome	224	Y
F030486	Metagenome / Metatranscriptome	185	Y
F050777	Metagenome / Metatranscriptome	145	N
F092111	Metagenome / Metatranscriptome	107	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0101727_114082	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	830
Ga0101727_115276	Not Available	782
Ga0101727_115615	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	769
Ga0101727_117591	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.	708

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0101727_114082	Ga0101727_1140822	F020363	VARVFALVVRCRDMMLFVYSRVGKNRDTKRESPAGAGAGRAADHLTVLFSQGILAVRRGNDIYRPVSHRALFSLFSHDLRRLFLPKY*
Ga0101727_115276	Ga0101727_1152762	F050777	MEDDIIYEKAVEILNPGRLYFALKAMRSSPVKISFDMGDLNLTSGPVSSLISIEGNLPEEVLAMQWLVPLGDLKILQDLIPPDTYYWENRALVLEWQCDLVVDSTIDEKNPLESIEQEEEYRDQLLVSNREYRKLQMALDDCNSHIPQVLFSIYPDRLNFAVNCSQHDEIVGTMIQMKNQKEAR*
Ga0101727_115615	Ga0101727_1156151	F030486	RYVALPQSRGGACFCTRGAVQDYAVNSLFSRWQKP*
Ga0101727_117591	Ga0101727_1175911	F092111	VTPEKEEGSDVREMVWEMSRTTNKILIFGIILILAILAVLMYCGVITFPSLPNLVICS