| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006361 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114292 | Gp0119664 | Ga0079055 |
| Sample Name | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 AAIW_A metaT (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 13486745 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 4 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -28.2362 | Long. (o) | -38.4949 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056191 | Metagenome / Metatranscriptome | 138 | Y |
| F060086 | Metagenome / Metatranscriptome | 133 | Y |
| F103410 | Metagenome / Metatranscriptome | 101 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0079055_103443 | Not Available | 1151 | Open in IMG/M |
| Ga0079055_110137 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1421 | Open in IMG/M |
| Ga0079055_111804 | Not Available | 587 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0079055_100275 | Ga0079055_1002751 | F103410 | PSTFRHVVRRPVFELSLKNPWPKACCSRSLVVKKCRPKGLQSLIASLPGLSHKSPQTRRSTTTCILAQPTPTRPRASPFGALISVPAQHVLRRTPEGTSRTVLTDQIGLPKVSRPPQRRTFLHHPEASLEHASFRLPYYKTAQRLFSNTADHFCQHLRRHARVPDPGPTHRHSDDPKITFLPISLAFDRLARGPHGPGHTTPEGFACRFGCSTAPLLPGGIATTVSQPSHSTQKPLGHSTLCRTIRP* |
| Ga0079055_103443 | Ga0079055_1034433 | F060086 | MIIRTTAGQEDPFELDSSLLLSSGRHGEDSKRQYSIKLLYEHETPLLDDLAD* |
| Ga0079055_110137 | Ga0079055_1101371 | F056191 | HALTAEMSKTFPSGGSMHARVKLEGIDGRAPQERGACGLI* |
| Ga0079055_111804 | Ga0079055_1118041 | F056191 | MCNARVRHALTAEMSKTFPSGGSMHARVKLEGIDGRAPQERGACGLI |
| ⦗Top⦘ |