| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005772 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0116053 | Gp0118715 | Ga0078402 |
| Sample Name | Human lung microbial communities from Normal Smokers Background 100804-1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | New York University Langone Medical Center |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 28862664 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Lung Microbial Communites From Healthy (Non-Smokers And Smokers) And Hiv Infected Subjects |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Respiratory System → Lung → Unclassified → Lung Microbiome → Human Lung Microbial Communites From Healthy (Non-Smokers And Smokers) And Hiv Infected Subjects |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | New York City, New York, USA | |||||||
| Coordinates | Lat. (o) | 40.7127 | Long. (o) | -74.0059 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0078402_136822 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0078402_136822 | Ga0078402_1368221 | F077438 | MECPITQSSFETLFLWNLKVENSSDLMPTVEKEISSNKN* |
| ⦗Top⦘ |