3300005767: Human lung microbial communities from HIV infected subject HIV3-1

Overview

Basic Information

• IMG/M Taxon OID: 3300005767
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0116053 | Gp0118704 | Ga0078197
• Sample Name: Human lung microbial communities from HIV infected subject HIV3-1
• Sequencing Status: Permanent Draft
• Sequencing Center: New York University Langone Medical Center
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 21915443
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Lung Microbial Communites From Healthy (Non-Smokers And Smokers) And Hiv Infected Subjects
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Respiratory System → Lung → Unclassified → Lung Microbiome → Human Lung Microbial Communites From Healthy (Non-Smokers And Smokers) And Hiv Infected Subjects

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal corpus

Location Information

• Location: New York City, New York, USA
• Coordinates
  • Lat. (^o): 40.7127
  • Long. (^o): -74.0059
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077438	Metagenome / Metatranscriptome	117	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0078197_123226	Not Available	524

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0078197_123226	Ga0078197_1232261	F077438	DEPSFRKSRFETLFLWSFHVEISIALRPKVEKETSSYKN*