NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005274

3300005274: Thermophilic enriched microbial communities from mini bioreactor at UC Davis - Sample SG0.5JP960



Overview

Basic Information
IMG/M Taxon OID3300005274 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063625 | Gp0053839 | Ga0065724
Sample NameThermophilic enriched microbial communities from mini bioreactor at UC Davis - Sample SG0.5JP960
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size70257324
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSwitchgrass Adapted Compost Microbial Communities From Mini Bioreactor At Uc Davis
TypeEngineered
TaxonomyEngineered → Solid Waste → Grass → Composting → Bioreactor → Switchgrass Adapted Compost → Switchgrass Adapted Compost Microbial Communities From Mini Bioreactor At Uc Davis

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUniversity of California, Davis, USA
CoordinatesLat. (o)38.546Long. (o)-121.7533Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036417Metagenome / Metatranscriptome170Y
F098955Metagenome / Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0065724_111865All Organisms → cellular organisms → Bacteria1732Open in IMG/M
Ga0065724_113561All Organisms → cellular organisms → Bacteria1038Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0065724_111865Ga0065724_1118651F098955MDSSAIPIYMAGPFPVLYTSFINELENEVELDVALLIGGLPNMIAATRLPLDETWYRIEAALQSGDARLGVAGMPYRGESVMGVTEVYPSAYIGLECANGERLVLARIRGHDPNQEAEAYARDVIAAILKGHTPADLGEFIDV*
Ga0065724_113561Ga0065724_1135612F036417MIQPARVPLRTRIPTVLVRLATDEGEIAFRARWRRSARELHHIILFKMRQGRPLWFQDEWGHDLVFRPECVWAAMVDGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.