| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005274 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063625 | Gp0053839 | Ga0065724 |
| Sample Name | Thermophilic enriched microbial communities from mini bioreactor at UC Davis - Sample SG0.5JP960 |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 70257324 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Switchgrass Adapted Compost Microbial Communities From Mini Bioreactor At Uc Davis |
| Type | Engineered |
| Taxonomy | Engineered → Solid Waste → Grass → Composting → Bioreactor → Switchgrass Adapted Compost → Switchgrass Adapted Compost Microbial Communities From Mini Bioreactor At Uc Davis |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | University of California, Davis, USA | |||||||
| Coordinates | Lat. (o) | 38.546 | Long. (o) | -121.7533 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036417 | Metagenome / Metatranscriptome | 170 | Y |
| F098955 | Metagenome / Metatranscriptome | 103 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0065724_111865 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| Ga0065724_113561 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0065724_111865 | Ga0065724_1118651 | F098955 | MDSSAIPIYMAGPFPVLYTSFINELENEVELDVALLIGGLPNMIAATRLPLDETWYRIEAALQSGDARLGVAGMPYRGESVMGVTEVYPSAYIGLECANGERLVLARIRGHDPNQEAEAYARDVIAAILKGHTPADLGEFIDV* |
| Ga0065724_113561 | Ga0065724_1135612 | F036417 | MIQPARVPLRTRIPTVLVRLATDEGEIAFRARWRRSARELHHIILFKMRQGRPLWFQDEWGHDLVFRPECVWAAMVDGR* |
| ⦗Top⦘ |