 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300004954 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046785 | Gp0111059 | Ga0066626 |
| Sample Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI054_120m_RNA (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 17168782 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 4 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → coastal inlet → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 48.6 | Long. (o) | -123.5 | Alt. (m) | N/A | Depth (m) | 120 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021318 | Metagenome / Metatranscriptome | 219 | Y |
| F052640 | Metagenome / Metatranscriptome | 142 | N |
| F060086 | Metagenome / Metatranscriptome | 133 | Y |
| F092198 | Metagenome / Metatranscriptome | 107 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0066626_109929 | Not Available | 612 | Open in IMG/M |
| Ga0066626_151938 | Not Available | 536 | Open in IMG/M |
| Ga0066626_151986 | Not Available | 728 | Open in IMG/M |
| Ga0066626_157928 | Not Available | 1151 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0066626_109929 | Ga0066626_1099291 | F052640 | MTQIRTIDELEAQYYGHNRNLLRKADAPSTTSTAGMFNAI |
| Ga0066626_151938 | Ga0066626_1519381 | F092198 | TTEVEMTEQTISFIQKAEVISSGTGLAAAGAITIADVTGGGVHAVIDAGSKESGNCTWKVPAGHTGYVHGFWYDVDAVAAGVGTAEIALQVAHAESSGVANSETWRTVAKVTVVENDNDIVSATGGNQNNNGSFSFPGNIPFVVPAKAMVRLAAKSPAAVAVTAGFSMSVQGSGSGTT |
| Ga0066626_151986 | Ga0066626_1519861 | F021318 | YNGMQLWLNPVDKTVYASPSAPTYGFTESGAYPIYDYKAHQSGMKTAKDTFGNDSYVHDAFVDAEFKALAEDYVSDVKAGGRQRMAALRSNTNSAVDIVNVWETVLGKQDRTYAGKNLAKEIAVPNLLISIDTATKFSGMTQLDEGQLSQLKELTYTRQNFEASKYGLKFVIHEEARLKNVHNVLQDSIQVASNKVEQRQSFDVVSLADSSLTAKAAAGAWDTFVTSTDRSTANPLLDLGTS |
| Ga0066626_157928 | Ga0066626_1579282 | F060086 | MLRATAGQEDPFELDSNLLLSSGRHGEDRKRQYNLLYDHETPLLDDLADLLY* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |