Basic Information | |
---|---|
IMG/M Taxon OID | 3300003759 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053073 | Gp0101298 | Ga0055525 |
Sample Name | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 99127822 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
Type | Host-Associated |
Taxonomy | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: North Carolina | |||||||
Coordinates | Lat. (o) | 35.6667 | Long. (o) | -78.5097 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031516 | Metagenome / Metatranscriptome | 182 | Y |
F045820 | Metagenome / Metatranscriptome | 152 | Y |
F087885 | Metagenome / Metatranscriptome | 110 | Y |
F101290 | Metagenome | 102 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0055525_1001574 | Not Available | 3731 | Open in IMG/M |
Ga0055525_1001612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3555 | Open in IMG/M |
Ga0055525_1013085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 701 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0055525_1001574 | Ga0055525_10015742 | F031516 | MMHFDTAQMSAITQAHFFSRVAEFIRDQTTVPAYRQAALDTTLRTALWAPHWATLRDASEHDAALFMCFLLACATLGVDHTRAAEAVRQSSQPETSMKLFLSERG |
Ga0055525_1001612 | Ga0055525_10016125 | F045820 | ANAPTPRPRSDDRTRDDLPDGRNGRVVGENDDNVLESIGKAVVAPVEGADEGAEPVDGQHGRAFVDLTKTLPQGQQAAPRTPTAPKPQGKAL* |
Ga0055525_1013085 | Ga0055525_10130852 | F087885 | AVRKSCGAMISLSVRPGQTRDSATEPPLARASMFRAKRFITSVEIRLR* |
Ga0055525_1019489 | Ga0055525_10194891 | F101290 | DSPETAASLYGQSVSLPRQATACAERIADYMPRFQKFFDAWRTENAAQIAAGSKFIHEQAAKGGVDADAGMAKLADADVERLRKTSTELLARHCQLILESLAPPSVN* |
⦗Top⦘ |