Metagenome / Metatranscriptome Family F087885

Overview

Basic Information

• Family ID: F087885
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 110
• Average Sequence Length: 40 residues
• Representative Sequence: ISRSVRPGHSRDSATEPPLARAIMFRAKRPMISVEIRLR
• Number of Associated Samples: 101
• Number of Associated Scaffolds: 110

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 2.73 %
• % of genes near scaffold ends (potentially truncated): 95.45 %
• % of genes from short scaffolds (< 2000 bps): 90.00 %
• Associated GOLD sequencing projects: 98
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (92.727 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.182 % of family members)
• Environment Ontology (ENVO): Unclassified (31.818 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (45.455 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 31.34%
  β-sheet: 0.00%
  Coil/Unstructured: 68.66%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF01189	Methyltr_RsmB-F	88.18
PF07896	DUF1674	0.91
PF03009	GDPD	0.91
PF00565	SNase	0.91
PF02142	MGS	0.91
PF03734	YkuD	0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 110 Family Scaffolds
COG0144	16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family	Translation, ribosomal structure and biogenesis [J]	88.18
COG0584	Glycerophosphoryl diester phosphodiesterase	Lipid transport and metabolism [I]	0.91
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.91
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.91
COG5508	Uncharacterized conserved protein, DUF1674 domain	Function unknown [S]	0.91

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	92.73 %
Unclassified	root	N/A	7.27 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	92.73 %
Unclassified	root	N/A	7.27 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	92.73 %
Unclassified	root	N/A	7.27 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	91.82 %
Unclassified	root	N/A	7.27 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.91 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	89.09 %
Unclassified	root	N/A	7.27 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.91 %

Level 6

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	71.82 %
Unclassified	root	N/A	7.27 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.91 %

Level 7

Name	Rank	Taxonomy	Distribution
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	58.18 %
Unclassified	root	N/A	7.27 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.91 %

Level 8

Name	Rank	Taxonomy	Distribution
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	58.18 %
Unclassified	root	N/A	7.27 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.91 %

Level 9

Name	Rank	Taxonomy	Distribution
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	50.91 %
Unclassified	root	N/A	7.27 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.91 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.91 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000955|JGI1027J12803_108083104	Not Available	554
3300001454|JGI20204J15135_1017360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	668
3300001593|JGI12635J15846_10368766	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	875
3300001661|JGI12053J15887_10030447	All Organisms → cellular organisms → Bacteria → Proteobacteria	3032
3300001661|JGI12053J15887_10512510	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	572
3300002245|JGIcombinedJ26739_101413842	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	589
3300002245|JGIcombinedJ26739_101452165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	580
3300003759|Ga0055525_1013085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	701
3300005332|Ga0066388_106330544	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	597
3300005336|Ga0070680_100881291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	772
3300005353|Ga0070669_101912742	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	518
3300005364|Ga0070673_101667250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	603
3300005435|Ga0070714_100900409	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	859
3300005440|Ga0070705_101860436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	511
3300005455|Ga0070663_100755104	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	831
3300005552|Ga0066701_10949714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	509
3300005564|Ga0070664_101551778	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	627
3300005569|Ga0066705_10488094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	772
3300005577|Ga0068857_100636352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1010
3300005602|Ga0070762_10359629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	930
3300005660|Ga0073904_10029682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3631
3300005764|Ga0066903_108272009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	532
3300005844|Ga0068862_100698531	Not Available	982
3300005985|Ga0081539_10043751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	2592
3300006028|Ga0070717_11680787	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	575
3300006806|Ga0079220_12158525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	500
3300006852|Ga0075433_10457044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1125
3300006854|Ga0075425_103166935	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	501
3300006950|Ga0075524_10123936	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1113
3300007819|Ga0104322_112065	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1133
3300009091|Ga0102851_10613368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1139
3300009093|Ga0105240_10117059	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3214
3300009093|Ga0105240_12005478	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	601
3300009101|Ga0105247_10523774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	867
3300009148|Ga0105243_12931320	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	517
3300009545|Ga0105237_11055756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	819
3300009553|Ga0105249_12382884	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	602
3300009800|Ga0105069_1024392	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	632
3300010044|Ga0126310_10346267	Not Available	1040
3300010375|Ga0105239_10132102	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2778
3300010376|Ga0126381_102881128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	685
3300010397|Ga0134124_11025791	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	838
3300010861|Ga0126349_1020891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1426
3300011119|Ga0105246_11668065	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	605
3300012149|Ga0153941_1016627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1580
3300012351|Ga0137386_11275218	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	510
3300012361|Ga0137360_11039546	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	707
3300012469|Ga0150984_105241797	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	862
3300012685|Ga0137397_10985612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	621
3300012915|Ga0157302_10446657	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	545
3300012961|Ga0164302_10530297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	838
3300013296|Ga0157374_12790636	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	516
3300014489|Ga0182018_10146357	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1352
3300014745|Ga0157377_10696646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	737
3300014969|Ga0157376_12090415	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	605
3300015053|Ga0137405_1326587	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	2980
3300015241|Ga0137418_11166471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	544
3300015371|Ga0132258_12657749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1249
3300015371|Ga0132258_12783137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1219
3300015373|Ga0132257_101932171	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	760
3300015373|Ga0132257_102183807	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	716
3300015373|Ga0132257_103843891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	546
3300018009|Ga0187884_10307071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	641
3300018920|Ga0190273_11509122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	594
3300020060|Ga0193717_1169248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	623
3300021403|Ga0210397_10280097	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1219
3300021403|Ga0210397_10370166	All Organisms → cellular organisms → Bacteria → Proteobacteria	1066
3300021404|Ga0210389_10215735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1498
3300021405|Ga0210387_10114226	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2274
3300021479|Ga0210410_11158890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	664
3300021860|Ga0213851_1850917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1681
3300024123|Ga0228600_1017276	Not Available	592
3300024347|Ga0179591_1162766	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	5106
3300025250|Ga0209026_1056436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	555
3300025494|Ga0207928_1095107	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	547
3300025906|Ga0207699_10633407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	780
3300025911|Ga0207654_10033711	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2841
3300025911|Ga0207654_10253127	Not Available	1181
3300025916|Ga0207663_10120138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1798
3300025928|Ga0207700_11579398	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	581
3300025931|Ga0207644_11586985	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	549
3300025942|Ga0207689_10563782	Not Available	957
3300026067|Ga0207678_10048345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3677
3300026095|Ga0207676_12310506	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	535
3300026121|Ga0207683_10255959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1598
3300026285|Ga0209438_1029595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1819
3300026295|Ga0209234_1025493	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2246
3300026530|Ga0209807_1232175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	627
3300027480|Ga0208993_1017805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1243
3300027562|Ga0209735_1106593	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	611
3300027884|Ga0209275_10476002	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	710
3300028794|Ga0307515_10315569	Not Available	1234
3300028802|Ga0307503_10834827	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	528
3300028810|Ga0307294_10280662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	599
3300030520|Ga0311372_11656629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	775
3300031057|Ga0170834_112600946	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	704
3300031521|Ga0311364_12149125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	546
3300031545|Ga0318541_10862434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	505
3300031548|Ga0307408_100591519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	985
3300031726|Ga0302321_100981118	Not Available	961
3300031736|Ga0318501_10459436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	692
3300031831|Ga0318564_10487019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	536
3300031896|Ga0318551_10081367	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1696
3300031912|Ga0306921_12225269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	577
3300031954|Ga0306926_10442234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1602
3300031954|Ga0306926_11253571	All Organisms → cellular organisms → Bacteria → Proteobacteria	868
3300031996|Ga0308176_10927888	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	915
3300034159|Ga0370509_0137154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	849
3300034281|Ga0370481_0380949	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	519
3300034820|Ga0373959_0099940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	689

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	62.73%
Host-Associated	Host-Associated	36.36%
Engineered	Engineered	0.91%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	60.00%
Plants	Host-Associated → Plants	35.45%
Aquatic	Environmental → Aquatic	2.73%
Fungi	Host-Associated → Fungi	0.91%
Wastewater	Engineered → Wastewater	0.91%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	57.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere	21.82%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.00%
Roots	Host-Associated → Plants → Roots	3.64%
Freshwater	Environmental → Aquatic → Freshwater	2.73%
Peat	Environmental → Terrestrial → Peat	2.73%
Mycelium	Host-Associated → Fungi → Mycelium	0.91%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.91%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	37.27%
Loam	Environmental → Terrestrial → Soil → Loam	16.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.55%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.27%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.55%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.55%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.73%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.73%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.82%
Unclassified	Host-Associated → Plants → Roots → Unclassified	1.82%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.91%
Sand	Environmental → Terrestrial → Soil → Sand	0.91%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.91%
Endophytes	Host-Associated → Plants → Roots → Endophytes	0.91%
Epiphytes	Host-Associated → Plants → Roots → Epiphytes	0.91%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.91%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.91%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	15.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.55%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	11.82%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	10.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.27%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.36%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.55%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.55%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	2.73%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.73%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.82%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	1.82%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.91%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.91%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.91%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.91%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.91%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.91%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.91%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.91%
Unclassified	Host-Associated → Plants → Roots → Endophytes → Unclassified	0.91%
Unclassified	Host-Associated → Plants → Roots → Epiphytes → Unclassified	0.91%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.91%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.91%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.18%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	6.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.45%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.45%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	5.45%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.55%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.64%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	2.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.73%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.73%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.73%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.73%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.82%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	1.82%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.82%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.82%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	1.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.82%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.82%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.91%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.91%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.91%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.91%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.91%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.91%
Permafrost Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil	0.91%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.91%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.91%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.91%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.91%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.91%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.91%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.91%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.91%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.91%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.91%
Arabidopsis Root	Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root	0.91%
Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots	0.91%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	0.91%
Arabidopsis Root	Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root	0.91%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.91%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.91%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.91%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.91%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.91%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.91%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300001454	Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012	Environmental
3300001593	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2	Environmental
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental
3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Host-Associated
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental
3300005660	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate	Engineered
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006950	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one	Environmental
3300007819	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo	Environmental
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009800	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40	Environmental
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010861	Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300012149	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ025 MetaG	Host-Associated
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental
3300012915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2	Environmental
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300014489	Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG	Environmental
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015053	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)	Environmental
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated
3300018009	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40	Environmental
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental
3300020060	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2	Environmental
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental
3300021479	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M	Environmental
3300021860	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)	Environmental
3300024123	Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5	Host-Associated
3300024347	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)	Environmental
3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes)	Host-Associated
3300025494	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes)	Environmental
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated
3300026285	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)	Environmental
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental
3300026530	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)	Environmental
3300027480	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)	Environmental
3300027562	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)	Environmental
3300027884	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)	Environmental
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental
3300028810	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151	Environmental
3300030520	III_Palsa_N2 coassembly	Environmental
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031521	III_Fen_E2 coassembly	Environmental
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental
3300031736	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21	Environmental
3300031831	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20	Environmental
3300031896	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19	Environmental
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental
3300034159	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_0210_18	Environmental
3300034281	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15	Environmental
3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI1027J12803_1080831041	3300000955	Soil	VRKSCGAMIRRSARPGHSRDNANVLPLARAARLRAKRPAISVEMRLR*
JGI20204J15135_10173601	3300001454	Arctic Peat Soil	CGAMIRRSVRPGHSHDSATEPPPARDITVRAKRPRISVEMRLR*
JGI12635J15846_103687662	3300001593	Forest Soil	GAMMRRSVRPGHSRDSATEPPLARAIMFRAKRPMISVEMRLR*
JGI12053J15887_100304472	3300001661	Forest Soil	MIRRSVRPGHSRDSATEPPLARDIMFRAKRPMISVEIRLR*
JGI12053J15887_105125101	3300001661	Forest Soil	VRPGHSRDNATEPPLARAMMLRAKRPTISVEIRLR*
JGIcombinedJ26739_1014138421	3300002245	Forest Soil	CGAMISLSARPGHSRDNATVLPLARATIVRAKRPMISVEMRLR*
JGIcombinedJ26739_1014521652	3300002245	Forest Soil	ISRSVRPGHSRDSATEPPLARAIMFRAKRPMISVEIRLR*
Ga0055525_10130852	3300003759	Arabidopsis Root	AVRKSCGAMISLSVRPGQTRDSATEPPLARASMFRAKRFITSVEIRLR*
Ga0066388_1063305442	3300005332	Tropical Forest Soil	AARVASAVRKSWGAMISRSVRPGQSLDSATELPLTRAIMFRAKRPIISVEMRLR*
Ga0070680_1008812911	3300005336	Corn Rhizosphere	CGAMISRSVRPGHNFDSATELPLARAIMFRAKRPMIRVEMRLR*
Ga0070669_1019127421	3300005353	Switchgrass Rhizosphere	AVRRSCGAMISRSERPGHSRDNASVPPLARAITLRAKRPMISVEIRLR*
Ga0070673_1016672502	3300005364	Switchgrass Rhizosphere	SCGAMISRSVRPGHNRDKATDPPLARAIAFRAKRPMISVEIRLR*
Ga0070714_1009004092	3300005435	Agricultural Soil	ASAVRKSCGAMIRRSVRPGHKRDNATEPRLARAINWRAKRLKISVEMRLR*
Ga0070705_1018604361	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MISRSARPGHSRDTATVAPVARAITVRAERLMISVEMRLR*
Ga0070663_1007551042	3300005455	Corn Rhizosphere	VRRSCGAMINRSERPGHNRDSATVPLLARAIKDRAKRPMISVEIRLR*
Ga0066701_109497142	3300005552	Soil	CGAMISRSARPGHSRDSANVLPLARATTLRAKRPAISVEMRLR*
Ga0070664_1015517781	3300005564	Corn Rhizosphere	SARPGHSRDNATVLPLARATMLRAKRPMISVEMRLR*
Ga0066705_104880942	3300005569	Soil	SCGAMMRRSVRPGQSRDSETEPPLARAMMPRAKRPMINVEMRLR*
Ga0068857_1006363521	3300005577	Corn Rhizosphere	ISRSARPGHSRDNASVEPLARAARLRAKRPAISVEMRLR*
Ga0070762_103596291	3300005602	Soil	CGAMISRSVRPGHNFDSATELLLARAIMFRAKRPMIRVEMRLR*
Ga0073904_100296821	3300005660	Activated Sludge	RPGHSRDTATEPPLTREIMFRAKRPRISVEIRLR*
Ga0066903_1082720091	3300005764	Tropical Forest Soil	ASAVRRSCGAMIRRSARPGQTRDNAKELPLTRAIMLRAKRPIISVEMRLR*
Ga0068862_1006985311	3300005844	Switchgrass Rhizosphere	MISRSARPGHSRDTATVAPVARATTVRAERLKISAEMRLR*
Ga0081539_100437514	3300005985	Tabebuia Heterophylla Rhizosphere	RSWGAMLSRWAGPGHSRETATVAPVARAITVRAERLMISVEMRLR*
Ga0070717_116807872	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	SRSERPGHSRDNATVLPLARAIMLRAKRPMISVEMRLR*
Ga0079220_121585251	3300006806	Agricultural Soil	RVASAVRRSCGAMISRSVRPGHNFDSAIELPLARAIMFRAKRPMIRVEMRLR*
Ga0075433_104570441	3300006852	Populus Rhizosphere	RRSARPGHSRESATEPPLTRAIMFRAKRPMISPEMDLR*
Ga0075425_1031669351	3300006854	Populus Rhizosphere	SCGAMIRRSERPGHSRDSATVPPLARAIKFRAKRPMISVEIRLR*
Ga0075524_101239361	3300006950	Arctic Peat Soil	RPGHSRDSATEPPLARANMFRAKRPMISVEMRLR*
Ga0104322_1120652	3300007819	Permafrost Soil	SVRPGHSRDSATEPPPARDITVRAKRPMISVEMRLR*
Ga0102851_106133682	3300009091	Freshwater Wetlands	RPGHSRDSATEPPLTRAIMFRAKRPMISVEIRLR*
Ga0105240_101170595	3300009093	Corn Rhizosphere	VRPGHTRDSATEPPLARAITLRAKRPTIRVEMRLR*
Ga0105240_120054782	3300009093	Corn Rhizosphere	SVRPGQTRDSATEPPLARASMFRAKRFMTSVEIRLR*
Ga0105247_105237741	3300009101	Switchgrass Rhizosphere	SVRPGHSRDSATVLPLARASTLRAKRPAISVEMRLR*
Ga0105243_129313202	3300009148	Miscanthus Rhizosphere	MISRSARPGHIRETATVALLARAITDRAERLMISVEMRLR*
Ga0105237_110557561	3300009545	Corn Rhizosphere	ARPGHSRDNATVPPLARAAMFRAKRPMMSVEMRLR*
Ga0105249_123828842	3300009553	Switchgrass Rhizosphere	RPGHSRDSATVLPDARAIRLRAKRPPISVEMRLR*
Ga0105069_10243922	3300009800	Groundwater Sand	CGAMISRSARPGHIRETATVALLARAITDRAERLMISVEMRLR*
Ga0126310_103462672	3300010044	Serpentine Soil	SARPGQSRDSPKVLPLARAITLRAKRLATSVVMRLR*
Ga0105239_101321021	3300010375	Corn Rhizosphere	ARVASAVRKSWGAMIRRSDRPGHSRDNATVPPLARAIIVRAKRPMISVEMRLR*
Ga0126381_1028811281	3300010376	Tropical Forest Soil	LRSWGAMISRSARPGHSLDSPTDALLTRAITFRAKRPMISVEMLLR*
Ga0134124_110257912	3300010397	Terrestrial Soil	ISRSARPGHIRETATVALLARAITDRAERLMISVEMRLR*
Ga0126349_10208911	3300010861	Boreal Forest Soil	RPGHSRASATELPLTRATMFRATRPMISVEMRLR*
Ga0105246_116680651	3300011119	Miscanthus Rhizosphere	GAMISRSARPGHSRDTVTVALEARAITVRAERLMISVEMRLR*
Ga0153941_10166272	3300012149	Attine Ant Fungus Gardens	SVRPGQSRDSATVLPLARASMLRANRPAISVEMRLL*
Ga0137386_112752182	3300012351	Vadose Zone Soil	RPGHSRDSASVLPLARATTLRAKRPATSVEMRLR*
Ga0137360_110395462	3300012361	Vadose Zone Soil	CGPMISRSVRPRQSRDEATEPPLARAIAFRAKRPMISVEIRLR*
Ga0150984_1052417971	3300012469	Avena Fatua Rhizosphere	RSERPGHSCDNATGPPVARDIKLRAKRSMISVEMRLR*
Ga0137397_109856121	3300012685	Vadose Zone Soil	MMRRSVRPGQSRDNATEPPLARAIAFRAKRPMISVEMRLR*
Ga0157302_104466572	3300012915	Soil	RPGHSRDSATVLPDARAIRLRAKRPAISVEMRLR*
Ga0164302_105302971	3300012961	Soil	RPGHSRDSPTVLPLARAITLRAKRLATSVVMRLR*
Ga0157374_127906362	3300013296	Miscanthus Rhizosphere	SVRPGQTRDSATEPPLARASMFRAKRFITSVEIRLR*
Ga0182018_101463571	3300014489	Palsa	SVRPGHSRDSATELPLARAIMFRAKRPMISVEIRLR*
Ga0157377_106966462	3300014745	Miscanthus Rhizosphere	ARPGHSRDTATVAPVARAITVRAERLMISVEMRLR*
Ga0157376_120904152	3300014969	Miscanthus Rhizosphere	ARPGHSRDNASVEPLARAARLRAKRPAISVEMRLR*
Ga0137405_13265874	3300015053	Vadose Zone Soil	MISAIGAAGHSRVTATEPPLTRAIMFRAKRPMISVEIRLR*
Ga0137418_111664712	3300015241	Vadose Zone Soil	VRPGHSRDSATEPPLARAIMFRAKRPMISVEMRLR*
Ga0132258_126577492	3300015371	Arabidopsis Rhizosphere	RPGHSRDSATVPPLARAITFRAKRFMISVDIRLR*
Ga0132258_127831371	3300015371	Arabidopsis Rhizosphere	IRRSERPGHSRDSATVLPLARAIMFRAKRPMISVEIRLR*
Ga0132257_1019321712	3300015373	Arabidopsis Rhizosphere	GAMISLSARPGHSRDSASVLPLARAIRLRTKRPAISVEMRLR*
Ga0132257_1021838072	3300015373	Arabidopsis Rhizosphere	MISRSVRPGHSRDSATVPPLARAIMLRAKRPAISVEMRLR*
Ga0132257_1038438912	3300015373	Arabidopsis Rhizosphere	CGAMIRRSARPGHNRDSATALLLARATRPRAKRSTISVEIRLR*
Ga0187884_103070711	3300018009	Peatland	SERPGHSRDSVTEPPLARAIMFRAKRPMISVEIRLR
Ga0190273_115091222	3300018920	Soil	VRPGHSRESATEPPLARAIRFRAKRFMISVEMRLR
Ga0193717_11692482	3300020060	Soil	SRSVRPGHSRDTATEPPLTRDIMFRAKRPRISVEIRLR
Ga0210397_102800971	3300021403	Soil	SERPGHSRDSATVPPLARAIIVRAKRPMISVEMRLR
Ga0210397_103701662	3300021403	Soil	ISRSVRPGHSRDNATVLPPARASTLRAKRPAISVEMRLR
Ga0210389_102157351	3300021404	Soil	AVRKSCGAMISRSARPGHSRDNATVLPLARATIVRAKRPMISVEMRLR
Ga0210387_101142263	3300021405	Soil	SVRPGHNRESATDPPLARAIMPRAKRPMISVEIRLR
Ga0210410_111588902	3300021479	Soil	SVRPGHSFDSATELPLTRATMLRAKRPMIRVEMRLR
Ga0213851_18509171	3300021860	Watersheds	RRSVRPGHSRDSATEPPLARAIIVRAKRPMISVEIRLR
Ga0228600_10172762	3300024123	Roots	SAARVASAVRRSCGAMMRRSVRPGHSDDNATEPLLARPNMLRATRPRISVEIRLC
Ga0179591_11627664	3300024347	Vadose Zone Soil	MISRSVRPGQSRDKATEPPLARAIAFRAKRPMISVEIRLR
Ga0209026_10564362	3300025250	Arabidopsis Root	RVASAVRKSCGAMISLSVRPGQTRDRATEPPLARASMFRAKRFITSVEIRLR
Ga0207928_10951071	3300025494	Arctic Peat Soil	VRPGHSRDRATEPPLTRAITFRAKRFRISVEMRLR
Ga0207699_106334071	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MISRSARPGHSRDKATEPPLARAIMVRAKRPMISVEIRLR
Ga0207654_100337115	3300025911	Corn Rhizosphere	ARPGQTRDSATEPPLARASMFRAKRFMTSVEIRLR
Ga0207654_102531272	3300025911	Corn Rhizosphere	SARPGHIRDTVTVAPVARAITVRAERLMISVEMRLR
Ga0207663_101201381	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	AMISRSVRPGHSFDSATEPPLARAITRRAKRPTIRDDMRLR
Ga0207700_115793982	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	ASAVRKSCGAMIRRSVRPGHKRDNATEPRLARAINWRAKRLKISVEMRLR
Ga0207644_115869851	3300025931	Switchgrass Rhizosphere	ARPGHSRDNASVEPLARAARLRAKRPAISVEMRLR
Ga0207689_105637821	3300025942	Miscanthus Rhizosphere	SARPGHSRDSATVPPLARAARLRAKRPAISVEIRLR
Ga0207678_100483456	3300026067	Corn Rhizosphere	RSARPGHSRDTVTVALEARAITVRAERLMISVEMRLR
Ga0207676_123105061	3300026095	Switchgrass Rhizosphere	INRSERPGHRCDNATEPPVARDIMLRAKRSTMSVEIRLR
Ga0207683_102559591	3300026121	Miscanthus Rhizosphere	AVRRSCGAMMRRSVRPGQSDVNATEMPLARAIKLRAKLLMISAEMRLL
Ga0209438_10295951	3300026285	Grasslands Soil	VRPGHSRVTATEPPLTRAIMFRAKRPMISVEMRLR
Ga0209234_10254934	3300026295	Grasslands Soil	MMRRSVRPGQSRDNVTEPPLARAMMLRAKRPMINVEMRLR
Ga0209807_12321751	3300026530	Soil	SARPGHSRDTATVAPVARAITVRAERLMISVEMRLR
Ga0208993_10178052	3300027480	Forest Soil	VRPGHSRDSATEPPLARDIMFRAKRPMISVEIRLR
Ga0209735_11065932	3300027562	Forest Soil	SRSVRPGHSRDSATVLSLARASTLRAKRLAISVEMRLR
Ga0209275_104760021	3300027884	Soil	ISRSVRPGHNFDSATELLLARAIMFRAKRPMIRVEMRLR
Ga0307515_103155691	3300028794	Ectomycorrhiza	RSARPGHSRDTATVAPVARAITVRAERLMISAEMRLR
Ga0307503_108348272	3300028802	Soil	RSARPGHSRDTATVAPVARAITVRAERLMISVDMRLR
Ga0307294_102806621	3300028810	Soil	SVRPGQSRDNATEPPLARAIALRAKRPMISVEIRLR
Ga0311372_116566291	3300030520	Palsa	MRRSVRPGHSRDNATEPPLARDIRFRAKRPMISVEIRLR
Ga0170834_1126009461	3300031057	Forest Soil	ISRSLRPGHSRDSATVEPLARATMLRARRPTISVEMRLR
Ga0311364_121491251	3300031521	Fen	SAVRRSWGAMIKRSERPGHSCDNATEPPVARDIMMRAKRFTISVEMRLR
Ga0318541_108624342	3300031545	Soil	SARPGHSRDIPTDALLTRAITLRAKRPMISVEMLLR
Ga0307408_1005915192	3300031548	Rhizosphere	SLSVRPGQTRDSATEPPLARASTFRAKRFMTSVEIRLR
Ga0302321_1009811181	3300031726	Fen	VRPGHSRDSATVPLLARATRFRAKRPAMSVEMRLR
Ga0318501_104594361	3300031736	Soil	ISRSVRPGHSRDNATEPPLTRATMVRAKRPMIRVEMRLR
Ga0318564_104870192	3300031831	Soil	VLRSWGAMISRSARPGHSLDKPTDALLTRAITFRAKRPMISVEMLLR
Ga0318551_100813671	3300031896	Soil	VLRSWGAMISRSARPGHSRDNPTDALLTRAITFRAKRPMISVEMRLR
Ga0306921_122252691	3300031912	Soil	ISRSVRPGHSFDSATEPPLARAITLRAKRPMTRVEMRLR
Ga0306926_104422342	3300031954	Soil	GAMINRSVRPGHIRDTATGPLLARASSFRAKRFMTSVEMRLR
Ga0306926_112535712	3300031954	Soil	MINRSVRPGHIRDTATGPLLARASSFRAKRFMTSVEMRLR
Ga0308176_109278882	3300031996	Soil	CGAMISLSVRPGQTRDSATEPPLARASTFRAKRFMTSVEIRLR
Ga0370509_0137154_718_849	3300034159	Untreated Peat Soil	CGAMIKRSVRPGHSRDTIAELCDARDATFRAKRPRISFDSRLR
Ga0370481_0380949_407_517	3300034281	Untreated Peat Soil	SARPGHSRDTATVAPVARAITLRAERLMISVEMRLR
Ga0373959_0099940_570_689	3300034820	Rhizosphere Soil	ISRSARPGHSRDSATVLPDARAIRLRAKRPAISVEMRLR