| Basic Information | |
|---|---|
| Family ID | F087885 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 40 residues |
| Representative Sequence | ISRSVRPGHSRDSATEPPLARAIMFRAKRPMISVEIRLR |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.73 % |
| % of genes near scaffold ends (potentially truncated) | 95.45 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.818 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.34% β-sheet: 0.00% Coil/Unstructured: 68.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01189 | Methyltr_RsmB-F | 88.18 |
| PF07896 | DUF1674 | 0.91 |
| PF03009 | GDPD | 0.91 |
| PF00565 | SNase | 0.91 |
| PF02142 | MGS | 0.91 |
| PF03734 | YkuD | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 88.18 |
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.91 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG5508 | Uncharacterized conserved protein, DUF1674 domain | Function unknown [S] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.73 % |
| Unclassified | root | N/A | 7.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_108083104 | Not Available | 554 | Open in IMG/M |
| 3300001454|JGI20204J15135_1017360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 668 | Open in IMG/M |
| 3300001593|JGI12635J15846_10368766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 875 | Open in IMG/M |
| 3300001661|JGI12053J15887_10030447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3032 | Open in IMG/M |
| 3300001661|JGI12053J15887_10512510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 572 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101413842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 589 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101452165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 580 | Open in IMG/M |
| 3300003759|Ga0055525_1013085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 701 | Open in IMG/M |
| 3300005332|Ga0066388_106330544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 597 | Open in IMG/M |
| 3300005336|Ga0070680_100881291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 772 | Open in IMG/M |
| 3300005353|Ga0070669_101912742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 518 | Open in IMG/M |
| 3300005364|Ga0070673_101667250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 603 | Open in IMG/M |
| 3300005435|Ga0070714_100900409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 859 | Open in IMG/M |
| 3300005440|Ga0070705_101860436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 511 | Open in IMG/M |
| 3300005455|Ga0070663_100755104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 831 | Open in IMG/M |
| 3300005552|Ga0066701_10949714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 509 | Open in IMG/M |
| 3300005564|Ga0070664_101551778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 627 | Open in IMG/M |
| 3300005569|Ga0066705_10488094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 772 | Open in IMG/M |
| 3300005577|Ga0068857_100636352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1010 | Open in IMG/M |
| 3300005602|Ga0070762_10359629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 930 | Open in IMG/M |
| 3300005660|Ga0073904_10029682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3631 | Open in IMG/M |
| 3300005764|Ga0066903_108272009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 532 | Open in IMG/M |
| 3300005844|Ga0068862_100698531 | Not Available | 982 | Open in IMG/M |
| 3300005985|Ga0081539_10043751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2592 | Open in IMG/M |
| 3300006028|Ga0070717_11680787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 575 | Open in IMG/M |
| 3300006806|Ga0079220_12158525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 500 | Open in IMG/M |
| 3300006852|Ga0075433_10457044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1125 | Open in IMG/M |
| 3300006854|Ga0075425_103166935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 501 | Open in IMG/M |
| 3300006950|Ga0075524_10123936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1113 | Open in IMG/M |
| 3300007819|Ga0104322_112065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1133 | Open in IMG/M |
| 3300009091|Ga0102851_10613368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1139 | Open in IMG/M |
| 3300009093|Ga0105240_10117059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3214 | Open in IMG/M |
| 3300009093|Ga0105240_12005478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 601 | Open in IMG/M |
| 3300009101|Ga0105247_10523774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 867 | Open in IMG/M |
| 3300009148|Ga0105243_12931320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 517 | Open in IMG/M |
| 3300009545|Ga0105237_11055756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 819 | Open in IMG/M |
| 3300009553|Ga0105249_12382884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 602 | Open in IMG/M |
| 3300009800|Ga0105069_1024392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 632 | Open in IMG/M |
| 3300010044|Ga0126310_10346267 | Not Available | 1040 | Open in IMG/M |
| 3300010375|Ga0105239_10132102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2778 | Open in IMG/M |
| 3300010376|Ga0126381_102881128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 685 | Open in IMG/M |
| 3300010397|Ga0134124_11025791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 838 | Open in IMG/M |
| 3300010861|Ga0126349_1020891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1426 | Open in IMG/M |
| 3300011119|Ga0105246_11668065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 605 | Open in IMG/M |
| 3300012149|Ga0153941_1016627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1580 | Open in IMG/M |
| 3300012351|Ga0137386_11275218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 510 | Open in IMG/M |
| 3300012361|Ga0137360_11039546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 707 | Open in IMG/M |
| 3300012469|Ga0150984_105241797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 862 | Open in IMG/M |
| 3300012685|Ga0137397_10985612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 621 | Open in IMG/M |
| 3300012915|Ga0157302_10446657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 545 | Open in IMG/M |
| 3300012961|Ga0164302_10530297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 838 | Open in IMG/M |
| 3300013296|Ga0157374_12790636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 516 | Open in IMG/M |
| 3300014489|Ga0182018_10146357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1352 | Open in IMG/M |
| 3300014745|Ga0157377_10696646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 737 | Open in IMG/M |
| 3300014969|Ga0157376_12090415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 605 | Open in IMG/M |
| 3300015053|Ga0137405_1326587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2980 | Open in IMG/M |
| 3300015241|Ga0137418_11166471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 544 | Open in IMG/M |
| 3300015371|Ga0132258_12657749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1249 | Open in IMG/M |
| 3300015371|Ga0132258_12783137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1219 | Open in IMG/M |
| 3300015373|Ga0132257_101932171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 760 | Open in IMG/M |
| 3300015373|Ga0132257_102183807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 716 | Open in IMG/M |
| 3300015373|Ga0132257_103843891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 546 | Open in IMG/M |
| 3300018009|Ga0187884_10307071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 641 | Open in IMG/M |
| 3300018920|Ga0190273_11509122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 594 | Open in IMG/M |
| 3300020060|Ga0193717_1169248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 623 | Open in IMG/M |
| 3300021403|Ga0210397_10280097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1219 | Open in IMG/M |
| 3300021403|Ga0210397_10370166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1066 | Open in IMG/M |
| 3300021404|Ga0210389_10215735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1498 | Open in IMG/M |
| 3300021405|Ga0210387_10114226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2274 | Open in IMG/M |
| 3300021479|Ga0210410_11158890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 664 | Open in IMG/M |
| 3300021860|Ga0213851_1850917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1681 | Open in IMG/M |
| 3300024123|Ga0228600_1017276 | Not Available | 592 | Open in IMG/M |
| 3300024347|Ga0179591_1162766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5106 | Open in IMG/M |
| 3300025250|Ga0209026_1056436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 555 | Open in IMG/M |
| 3300025494|Ga0207928_1095107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 547 | Open in IMG/M |
| 3300025906|Ga0207699_10633407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 780 | Open in IMG/M |
| 3300025911|Ga0207654_10033711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2841 | Open in IMG/M |
| 3300025911|Ga0207654_10253127 | Not Available | 1181 | Open in IMG/M |
| 3300025916|Ga0207663_10120138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1798 | Open in IMG/M |
| 3300025928|Ga0207700_11579398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 581 | Open in IMG/M |
| 3300025931|Ga0207644_11586985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 549 | Open in IMG/M |
| 3300025942|Ga0207689_10563782 | Not Available | 957 | Open in IMG/M |
| 3300026067|Ga0207678_10048345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3677 | Open in IMG/M |
| 3300026095|Ga0207676_12310506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 535 | Open in IMG/M |
| 3300026121|Ga0207683_10255959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1598 | Open in IMG/M |
| 3300026285|Ga0209438_1029595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1819 | Open in IMG/M |
| 3300026295|Ga0209234_1025493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2246 | Open in IMG/M |
| 3300026530|Ga0209807_1232175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 627 | Open in IMG/M |
| 3300027480|Ga0208993_1017805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1243 | Open in IMG/M |
| 3300027562|Ga0209735_1106593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 611 | Open in IMG/M |
| 3300027884|Ga0209275_10476002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 710 | Open in IMG/M |
| 3300028794|Ga0307515_10315569 | Not Available | 1234 | Open in IMG/M |
| 3300028802|Ga0307503_10834827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 528 | Open in IMG/M |
| 3300028810|Ga0307294_10280662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 599 | Open in IMG/M |
| 3300030520|Ga0311372_11656629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 775 | Open in IMG/M |
| 3300031057|Ga0170834_112600946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 704 | Open in IMG/M |
| 3300031521|Ga0311364_12149125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 546 | Open in IMG/M |
| 3300031545|Ga0318541_10862434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 505 | Open in IMG/M |
| 3300031548|Ga0307408_100591519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 985 | Open in IMG/M |
| 3300031726|Ga0302321_100981118 | Not Available | 961 | Open in IMG/M |
| 3300031736|Ga0318501_10459436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 692 | Open in IMG/M |
| 3300031831|Ga0318564_10487019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 536 | Open in IMG/M |
| 3300031896|Ga0318551_10081367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1696 | Open in IMG/M |
| 3300031912|Ga0306921_12225269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 577 | Open in IMG/M |
| 3300031954|Ga0306926_10442234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1602 | Open in IMG/M |
| 3300031954|Ga0306926_11253571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300031996|Ga0308176_10927888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 915 | Open in IMG/M |
| 3300034159|Ga0370509_0137154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 849 | Open in IMG/M |
| 3300034281|Ga0370481_0380949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 519 | Open in IMG/M |
| 3300034820|Ga0373959_0099940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 689 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.18% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.64% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.82% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.91% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.91% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.91% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root | 0.91% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.91% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.91% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.91% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.91% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001454 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005660 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate | Engineered | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009800 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012149 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ025 MetaG | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Host-Associated | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300034159 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_0210_18 | Environmental | Open in IMG/M |
| 3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1080831041 | 3300000955 | Soil | VRKSCGAMIRRSARPGHSRDNANVLPLARAARLRAKRPAISVEMRLR* |
| JGI20204J15135_10173601 | 3300001454 | Arctic Peat Soil | CGAMIRRSVRPGHSHDSATEPPPARDITVRAKRPRISVEMRLR* |
| JGI12635J15846_103687662 | 3300001593 | Forest Soil | GAMMRRSVRPGHSRDSATEPPLARAIMFRAKRPMISVEMRLR* |
| JGI12053J15887_100304472 | 3300001661 | Forest Soil | MIRRSVRPGHSRDSATEPPLARDIMFRAKRPMISVEIRLR* |
| JGI12053J15887_105125101 | 3300001661 | Forest Soil | VRPGHSRDNATEPPLARAMMLRAKRPTISVEIRLR* |
| JGIcombinedJ26739_1014138421 | 3300002245 | Forest Soil | CGAMISLSARPGHSRDNATVLPLARATIVRAKRPMISVEMRLR* |
| JGIcombinedJ26739_1014521652 | 3300002245 | Forest Soil | ISRSVRPGHSRDSATEPPLARAIMFRAKRPMISVEIRLR* |
| Ga0055525_10130852 | 3300003759 | Arabidopsis Root | AVRKSCGAMISLSVRPGQTRDSATEPPLARASMFRAKRFITSVEIRLR* |
| Ga0066388_1063305442 | 3300005332 | Tropical Forest Soil | AARVASAVRKSWGAMISRSVRPGQSLDSATELPLTRAIMFRAKRPIISVEMRLR* |
| Ga0070680_1008812911 | 3300005336 | Corn Rhizosphere | CGAMISRSVRPGHNFDSATELPLARAIMFRAKRPMIRVEMRLR* |
| Ga0070669_1019127421 | 3300005353 | Switchgrass Rhizosphere | AVRRSCGAMISRSERPGHSRDNASVPPLARAITLRAKRPMISVEIRLR* |
| Ga0070673_1016672502 | 3300005364 | Switchgrass Rhizosphere | SCGAMISRSVRPGHNRDKATDPPLARAIAFRAKRPMISVEIRLR* |
| Ga0070714_1009004092 | 3300005435 | Agricultural Soil | ASAVRKSCGAMIRRSVRPGHKRDNATEPRLARAINWRAKRLKISVEMRLR* |
| Ga0070705_1018604361 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MISRSARPGHSRDTATVAPVARAITVRAERLMISVEMRLR* |
| Ga0070663_1007551042 | 3300005455 | Corn Rhizosphere | VRRSCGAMINRSERPGHNRDSATVPLLARAIKDRAKRPMISVEIRLR* |
| Ga0066701_109497142 | 3300005552 | Soil | CGAMISRSARPGHSRDSANVLPLARATTLRAKRPAISVEMRLR* |
| Ga0070664_1015517781 | 3300005564 | Corn Rhizosphere | SARPGHSRDNATVLPLARATMLRAKRPMISVEMRLR* |
| Ga0066705_104880942 | 3300005569 | Soil | SCGAMMRRSVRPGQSRDSETEPPLARAMMPRAKRPMINVEMRLR* |
| Ga0068857_1006363521 | 3300005577 | Corn Rhizosphere | ISRSARPGHSRDNASVEPLARAARLRAKRPAISVEMRLR* |
| Ga0070762_103596291 | 3300005602 | Soil | CGAMISRSVRPGHNFDSATELLLARAIMFRAKRPMIRVEMRLR* |
| Ga0073904_100296821 | 3300005660 | Activated Sludge | RPGHSRDTATEPPLTREIMFRAKRPRISVEIRLR* |
| Ga0066903_1082720091 | 3300005764 | Tropical Forest Soil | ASAVRRSCGAMIRRSARPGQTRDNAKELPLTRAIMLRAKRPIISVEMRLR* |
| Ga0068862_1006985311 | 3300005844 | Switchgrass Rhizosphere | MISRSARPGHSRDTATVAPVARATTVRAERLKISAEMRLR* |
| Ga0081539_100437514 | 3300005985 | Tabebuia Heterophylla Rhizosphere | RSWGAMLSRWAGPGHSRETATVAPVARAITVRAERLMISVEMRLR* |
| Ga0070717_116807872 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SRSERPGHSRDNATVLPLARAIMLRAKRPMISVEMRLR* |
| Ga0079220_121585251 | 3300006806 | Agricultural Soil | RVASAVRRSCGAMISRSVRPGHNFDSAIELPLARAIMFRAKRPMIRVEMRLR* |
| Ga0075433_104570441 | 3300006852 | Populus Rhizosphere | RRSARPGHSRESATEPPLTRAIMFRAKRPMISPEMDLR* |
| Ga0075425_1031669351 | 3300006854 | Populus Rhizosphere | SCGAMIRRSERPGHSRDSATVPPLARAIKFRAKRPMISVEIRLR* |
| Ga0075524_101239361 | 3300006950 | Arctic Peat Soil | RPGHSRDSATEPPLARANMFRAKRPMISVEMRLR* |
| Ga0104322_1120652 | 3300007819 | Permafrost Soil | SVRPGHSRDSATEPPPARDITVRAKRPMISVEMRLR* |
| Ga0102851_106133682 | 3300009091 | Freshwater Wetlands | RPGHSRDSATEPPLTRAIMFRAKRPMISVEIRLR* |
| Ga0105240_101170595 | 3300009093 | Corn Rhizosphere | VRPGHTRDSATEPPLARAITLRAKRPTIRVEMRLR* |
| Ga0105240_120054782 | 3300009093 | Corn Rhizosphere | SVRPGQTRDSATEPPLARASMFRAKRFMTSVEIRLR* |
| Ga0105247_105237741 | 3300009101 | Switchgrass Rhizosphere | SVRPGHSRDSATVLPLARASTLRAKRPAISVEMRLR* |
| Ga0105243_129313202 | 3300009148 | Miscanthus Rhizosphere | MISRSARPGHIRETATVALLARAITDRAERLMISVEMRLR* |
| Ga0105237_110557561 | 3300009545 | Corn Rhizosphere | ARPGHSRDNATVPPLARAAMFRAKRPMMSVEMRLR* |
| Ga0105249_123828842 | 3300009553 | Switchgrass Rhizosphere | RPGHSRDSATVLPDARAIRLRAKRPPISVEMRLR* |
| Ga0105069_10243922 | 3300009800 | Groundwater Sand | CGAMISRSARPGHIRETATVALLARAITDRAERLMISVEMRLR* |
| Ga0126310_103462672 | 3300010044 | Serpentine Soil | SARPGQSRDSPKVLPLARAITLRAKRLATSVVMRLR* |
| Ga0105239_101321021 | 3300010375 | Corn Rhizosphere | ARVASAVRKSWGAMIRRSDRPGHSRDNATVPPLARAIIVRAKRPMISVEMRLR* |
| Ga0126381_1028811281 | 3300010376 | Tropical Forest Soil | LRSWGAMISRSARPGHSLDSPTDALLTRAITFRAKRPMISVEMLLR* |
| Ga0134124_110257912 | 3300010397 | Terrestrial Soil | ISRSARPGHIRETATVALLARAITDRAERLMISVEMRLR* |
| Ga0126349_10208911 | 3300010861 | Boreal Forest Soil | RPGHSRASATELPLTRATMFRATRPMISVEMRLR* |
| Ga0105246_116680651 | 3300011119 | Miscanthus Rhizosphere | GAMISRSARPGHSRDTVTVALEARAITVRAERLMISVEMRLR* |
| Ga0153941_10166272 | 3300012149 | Attine Ant Fungus Gardens | SVRPGQSRDSATVLPLARASMLRANRPAISVEMRLL* |
| Ga0137386_112752182 | 3300012351 | Vadose Zone Soil | RPGHSRDSASVLPLARATTLRAKRPATSVEMRLR* |
| Ga0137360_110395462 | 3300012361 | Vadose Zone Soil | CGPMISRSVRPRQSRDEATEPPLARAIAFRAKRPMISVEIRLR* |
| Ga0150984_1052417971 | 3300012469 | Avena Fatua Rhizosphere | RSERPGHSCDNATGPPVARDIKLRAKRSMISVEMRLR* |
| Ga0137397_109856121 | 3300012685 | Vadose Zone Soil | MMRRSVRPGQSRDNATEPPLARAIAFRAKRPMISVEMRLR* |
| Ga0157302_104466572 | 3300012915 | Soil | RPGHSRDSATVLPDARAIRLRAKRPAISVEMRLR* |
| Ga0164302_105302971 | 3300012961 | Soil | RPGHSRDSPTVLPLARAITLRAKRLATSVVMRLR* |
| Ga0157374_127906362 | 3300013296 | Miscanthus Rhizosphere | SVRPGQTRDSATEPPLARASMFRAKRFITSVEIRLR* |
| Ga0182018_101463571 | 3300014489 | Palsa | SVRPGHSRDSATELPLARAIMFRAKRPMISVEIRLR* |
| Ga0157377_106966462 | 3300014745 | Miscanthus Rhizosphere | ARPGHSRDTATVAPVARAITVRAERLMISVEMRLR* |
| Ga0157376_120904152 | 3300014969 | Miscanthus Rhizosphere | ARPGHSRDNASVEPLARAARLRAKRPAISVEMRLR* |
| Ga0137405_13265874 | 3300015053 | Vadose Zone Soil | MISAIGAAGHSRVTATEPPLTRAIMFRAKRPMISVEIRLR* |
| Ga0137418_111664712 | 3300015241 | Vadose Zone Soil | VRPGHSRDSATEPPLARAIMFRAKRPMISVEMRLR* |
| Ga0132258_126577492 | 3300015371 | Arabidopsis Rhizosphere | RPGHSRDSATVPPLARAITFRAKRFMISVDIRLR* |
| Ga0132258_127831371 | 3300015371 | Arabidopsis Rhizosphere | IRRSERPGHSRDSATVLPLARAIMFRAKRPMISVEIRLR* |
| Ga0132257_1019321712 | 3300015373 | Arabidopsis Rhizosphere | GAMISLSARPGHSRDSASVLPLARAIRLRTKRPAISVEMRLR* |
| Ga0132257_1021838072 | 3300015373 | Arabidopsis Rhizosphere | MISRSVRPGHSRDSATVPPLARAIMLRAKRPAISVEMRLR* |
| Ga0132257_1038438912 | 3300015373 | Arabidopsis Rhizosphere | CGAMIRRSARPGHNRDSATALLLARATRPRAKRSTISVEIRLR* |
| Ga0187884_103070711 | 3300018009 | Peatland | SERPGHSRDSVTEPPLARAIMFRAKRPMISVEIRLR |
| Ga0190273_115091222 | 3300018920 | Soil | VRPGHSRESATEPPLARAIRFRAKRFMISVEMRLR |
| Ga0193717_11692482 | 3300020060 | Soil | SRSVRPGHSRDTATEPPLTRDIMFRAKRPRISVEIRLR |
| Ga0210397_102800971 | 3300021403 | Soil | SERPGHSRDSATVPPLARAIIVRAKRPMISVEMRLR |
| Ga0210397_103701662 | 3300021403 | Soil | ISRSVRPGHSRDNATVLPPARASTLRAKRPAISVEMRLR |
| Ga0210389_102157351 | 3300021404 | Soil | AVRKSCGAMISRSARPGHSRDNATVLPLARATIVRAKRPMISVEMRLR |
| Ga0210387_101142263 | 3300021405 | Soil | SVRPGHNRESATDPPLARAIMPRAKRPMISVEIRLR |
| Ga0210410_111588902 | 3300021479 | Soil | SVRPGHSFDSATELPLTRATMLRAKRPMIRVEMRLR |
| Ga0213851_18509171 | 3300021860 | Watersheds | RRSVRPGHSRDSATEPPLARAIIVRAKRPMISVEIRLR |
| Ga0228600_10172762 | 3300024123 | Roots | SAARVASAVRRSCGAMMRRSVRPGHSDDNATEPLLARPNMLRATRPRISVEIRLC |
| Ga0179591_11627664 | 3300024347 | Vadose Zone Soil | MISRSVRPGQSRDKATEPPLARAIAFRAKRPMISVEIRLR |
| Ga0209026_10564362 | 3300025250 | Arabidopsis Root | RVASAVRKSCGAMISLSVRPGQTRDRATEPPLARASMFRAKRFITSVEIRLR |
| Ga0207928_10951071 | 3300025494 | Arctic Peat Soil | VRPGHSRDRATEPPLTRAITFRAKRFRISVEMRLR |
| Ga0207699_106334071 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MISRSARPGHSRDKATEPPLARAIMVRAKRPMISVEIRLR |
| Ga0207654_100337115 | 3300025911 | Corn Rhizosphere | ARPGQTRDSATEPPLARASMFRAKRFMTSVEIRLR |
| Ga0207654_102531272 | 3300025911 | Corn Rhizosphere | SARPGHIRDTVTVAPVARAITVRAERLMISVEMRLR |
| Ga0207663_101201381 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AMISRSVRPGHSFDSATEPPLARAITRRAKRPTIRDDMRLR |
| Ga0207700_115793982 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ASAVRKSCGAMIRRSVRPGHKRDNATEPRLARAINWRAKRLKISVEMRLR |
| Ga0207644_115869851 | 3300025931 | Switchgrass Rhizosphere | ARPGHSRDNASVEPLARAARLRAKRPAISVEMRLR |
| Ga0207689_105637821 | 3300025942 | Miscanthus Rhizosphere | SARPGHSRDSATVPPLARAARLRAKRPAISVEIRLR |
| Ga0207678_100483456 | 3300026067 | Corn Rhizosphere | RSARPGHSRDTVTVALEARAITVRAERLMISVEMRLR |
| Ga0207676_123105061 | 3300026095 | Switchgrass Rhizosphere | INRSERPGHRCDNATEPPVARDIMLRAKRSTMSVEIRLR |
| Ga0207683_102559591 | 3300026121 | Miscanthus Rhizosphere | AVRRSCGAMMRRSVRPGQSDVNATEMPLARAIKLRAKLLMISAEMRLL |
| Ga0209438_10295951 | 3300026285 | Grasslands Soil | VRPGHSRVTATEPPLTRAIMFRAKRPMISVEMRLR |
| Ga0209234_10254934 | 3300026295 | Grasslands Soil | MMRRSVRPGQSRDNVTEPPLARAMMLRAKRPMINVEMRLR |
| Ga0209807_12321751 | 3300026530 | Soil | SARPGHSRDTATVAPVARAITVRAERLMISVEMRLR |
| Ga0208993_10178052 | 3300027480 | Forest Soil | VRPGHSRDSATEPPLARDIMFRAKRPMISVEIRLR |
| Ga0209735_11065932 | 3300027562 | Forest Soil | SRSVRPGHSRDSATVLSLARASTLRAKRLAISVEMRLR |
| Ga0209275_104760021 | 3300027884 | Soil | ISRSVRPGHNFDSATELLLARAIMFRAKRPMIRVEMRLR |
| Ga0307515_103155691 | 3300028794 | Ectomycorrhiza | RSARPGHSRDTATVAPVARAITVRAERLMISAEMRLR |
| Ga0307503_108348272 | 3300028802 | Soil | RSARPGHSRDTATVAPVARAITVRAERLMISVDMRLR |
| Ga0307294_102806621 | 3300028810 | Soil | SVRPGQSRDNATEPPLARAIALRAKRPMISVEIRLR |
| Ga0311372_116566291 | 3300030520 | Palsa | MRRSVRPGHSRDNATEPPLARDIRFRAKRPMISVEIRLR |
| Ga0170834_1126009461 | 3300031057 | Forest Soil | ISRSLRPGHSRDSATVEPLARATMLRARRPTISVEMRLR |
| Ga0311364_121491251 | 3300031521 | Fen | SAVRRSWGAMIKRSERPGHSCDNATEPPVARDIMMRAKRFTISVEMRLR |
| Ga0318541_108624342 | 3300031545 | Soil | SARPGHSRDIPTDALLTRAITLRAKRPMISVEMLLR |
| Ga0307408_1005915192 | 3300031548 | Rhizosphere | SLSVRPGQTRDSATEPPLARASTFRAKRFMTSVEIRLR |
| Ga0302321_1009811181 | 3300031726 | Fen | VRPGHSRDSATVPLLARATRFRAKRPAMSVEMRLR |
| Ga0318501_104594361 | 3300031736 | Soil | ISRSVRPGHSRDNATEPPLTRATMVRAKRPMIRVEMRLR |
| Ga0318564_104870192 | 3300031831 | Soil | VLRSWGAMISRSARPGHSLDKPTDALLTRAITFRAKRPMISVEMLLR |
| Ga0318551_100813671 | 3300031896 | Soil | VLRSWGAMISRSARPGHSRDNPTDALLTRAITFRAKRPMISVEMRLR |
| Ga0306921_122252691 | 3300031912 | Soil | ISRSVRPGHSFDSATEPPLARAITLRAKRPMTRVEMRLR |
| Ga0306926_104422342 | 3300031954 | Soil | GAMINRSVRPGHIRDTATGPLLARASSFRAKRFMTSVEMRLR |
| Ga0306926_112535712 | 3300031954 | Soil | MINRSVRPGHIRDTATGPLLARASSFRAKRFMTSVEMRLR |
| Ga0308176_109278882 | 3300031996 | Soil | CGAMISLSVRPGQTRDSATEPPLARASTFRAKRFMTSVEIRLR |
| Ga0370509_0137154_718_849 | 3300034159 | Untreated Peat Soil | CGAMIKRSVRPGHSRDTIAELCDARDATFRAKRPRISFDSRLR |
| Ga0370481_0380949_407_517 | 3300034281 | Untreated Peat Soil | SARPGHSRDTATVAPVARAITLRAERLMISVEMRLR |
| Ga0373959_0099940_570_689 | 3300034820 | Rhizosphere Soil | ISRSARPGHSRDSATVLPDARAIRLRAKRPAISVEMRLR |
| ⦗Top⦘ |