3300003457: Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S12-DC09C

Overview

Basic Information

• IMG/M Taxon OID: 3300003457
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111425 | Gp0104225 | Ga0059310
• Sample Name: Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S12-DC09C
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 52589680
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp.	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine neritic zone → marine sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Sediment (saline)

Location Information

• Location: Douglas Channel, British Columbia, Canada
• Coordinates
  • Lat. (^o): 53.6667
  • Long. (^o): -129.1333
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053264	Metagenome / Metatranscriptome	141	Y
F105214	Metagenome / Metatranscriptome	100	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
DC09C_1160646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp.	537

Sequences

Scaffold ID	Protein ID	Family	Sequence
DC09C_1160646	DC09C_11606461	F053264	VGSPSVEKLQNGRYKLVVTCSTMNSREDWYSANKDRIFPDFGSLQSAEMSIDGLAPRTGEAYADMRLTQVESGNRSGMGQVGDYNVALTYETLGSSFVQVKDDNTDYELNGLRRVTRTSIAEAGTDYAKTVGSSYIDHQIDAETAVRCYLGSYGIDDTDSFRQVQEVYIEAGTLSETLD
DC09C_1421836	DC09C_14218361	F105214	IRDDAAKKLQKSENLFKLNSSPFRHMGRKRKTINGKSVKRSAFKNIK*