 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F105214 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AAKKLQKSENLFKLNSSPFRHMGRKRKKINGKSVKRSAFKNIK |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 3.00 % |
| % of genes from short scaffolds (< 2000 bps) | 1.00 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (12.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (38.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.63% β-sheet: 0.00% Coil/Unstructured: 94.37% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF07460 | NUMOD3 | 2.00 |
| PF02945 | Endonuclease_7 | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005581|Ga0049081_10000255 | Not Available | 21082 | Open in IMG/M |
| 3300015050|Ga0181338_1002463 | Not Available | 3252 | Open in IMG/M |
| 3300018421|Ga0181592_11007772 | Not Available | 536 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 5.00% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.00% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.00% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.00% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.00% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.00% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 2.00% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.00% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.00% |
| Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 1.00% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.00% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.00% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 1.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.00% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 1.00% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.00% |
| Marine Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment | 1.00% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876005 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15m | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003457 | Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S12-DC09C | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006421 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten I | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009135 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020495 | Freshwater microbial communities from Lake Mendota, WI - 20APR2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
| 3300024247 | Seawater microbial communities from Monterey Bay, California, United States - 36D_r | Environmental | Open in IMG/M |
| 3300024338 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027547 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028127 | Seawater microbial communities from Monterey Bay, California, United States - 49D | Environmental | Open in IMG/M |
| 3300028134 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_1485992 | 2236876005 | Marine Estuarine | MMLTKNLQKSNNLFKLNRTPFRHMGHGSKVINGQVFNRSAFKNLK |
| JGI12421J11937_100145241 | 3300000756 | Freshwater And Sediment | SENLFKLNRSPFRHVGGNKLSNRPEFKKSAFKNLK* |
| BS_KBA_SWE02_21mDRAFT_100586581 | 3300000792 | Marine | MAKNLQKSENLFKLNRSPFRHMGGSGSSLSKGVTRSPFKNIK* |
| JGIcombinedJ13530_1074383372 | 3300001213 | Wetland | AKNLQKSENLFKLNSSPFRHMGNNGRLTNGSVFKKSPFKNIK* |
| B570J14230_1000167614 | 3300001282 | Freshwater | QKSDNLYKLNTSPFRHMGKMRKVPGMSFPKSPFKNMR* |
| RCM31_101897492 | 3300001851 | Marine Plankton | LQKSENLFKLNSSPFRHMGGRGNLINGQAFKKSPFKNIK* |
| GOS2246_100789522 | 3300001974 | Marine | AAKKLQKSENLFKLNSSPFRHMGRKRKKINGKSVKRSAFKNIK* |
| B570J40625_1006407961 | 3300002835 | Freshwater | NLQKSENFSNLNNSPFRHLGKTHYDRGQGVKRSPFKNFK* |
| B570J40625_1008312711 | 3300002835 | Freshwater | AAKNLQKSENLFKLNKSMFKHMGHKTSNVNGGLKRSAFKNIK* |
| B570J40625_1010463951 | 3300002835 | Freshwater | KNLQKSENLFKLNKSPFRHMGGGMRNTMSGFQKSAFKNIK* |
| DC09C_14218361 | 3300003457 | Marine Sediment | IRDDAAKKLQKSENLFKLNSSPFRHMGRKRKTINGKSVKRSAFKNIK* |
| Ga0055584_1004851253 | 3300004097 | Pelagic Marine | AKKLQKSENLFKLNSSPFTHMGRKNKTSRGRGFKKSAFKNIK* |
| Ga0055584_1010231821 | 3300004097 | Pelagic Marine | AKKLQKSENLFKLNSSPFTHMGRKNKRINGKSRKRSAFKNIK* |
| Ga0049081_1000025528 | 3300005581 | Freshwater Lentic | AAKNLQKSENLFKLNKSPFRHIGNEVKNKMSGLKRSAFRNIK* |
| Ga0078894_111348461 | 3300005662 | Freshwater Lake | AKNLQKSENLFKLNKSPFRHMGGGMRNTMSGFQKSAFKNIK* |
| Ga0073913_100357111 | 3300005940 | Sand | AKNLQKSENLFKLNRSPFRHMGKGQLANGQGFKKSPFKNLK* |
| Ga0075470_100623652 | 3300006030 | Aqueous | LQKSENLFKLNSSPFRHMGSNGRLKNGNVFKKSPFKNIK* |
| Ga0082247_118600371 | 3300006421 | Sediment | KQVIRDDAAKKLQKSENLFKLNSSPFRHLSRKNKNVNGKSLKRSAFKNIKK* |
| Ga0098038_11578932 | 3300006735 | Marine | DDAAKKLQKSENLFKLNSSPFRHMGRKRKKINGKSIKRSAFKNIK* |
| Ga0098037_12901512 | 3300006737 | Marine | EKSKNLFKLNSSPFRHMGRKNKTSRGKGFKKSAFKNIK* |
| Ga0098048_10963002 | 3300006752 | Marine | IRDDAAKKLQKSENLFKLNSSPFRHMGRKNKTSRGRDFKKSAFKNIK* |
| Ga0075472_106114322 | 3300006917 | Aqueous | LQKSENLFKLNKSLFRHMGGKTKTINAGPQKSAFKHIK* |
| Ga0098045_10042731 | 3300006922 | Marine | NRGYTKQIIRDDAAKKLQKSENLFKLNSSPFRHMGRKNKTSRGRDFKKSAFKNIK* |
| Ga0102923_11334772 | 3300007606 | Estuarine | ASKNLQKSENLFKLNRSPFRHMGQGRGPLGGGINRSPFKNIK* |
| Ga0114351_13510022 | 3300008117 | Freshwater, Plankton | AAKNLQKSDNLFKLSVSPFRHMGKGRLANGQGYKRSPFKNFK* |
| Ga0114353_13470141 | 3300008264 | Freshwater, Plankton | SENLYKLSHTPFRHMGKGRNVMGQSFKRSAFKNFK* |
| Ga0102860_12371711 | 3300009056 | Estuarine | IMDDAAKNLQKSENLFKLNKSMFKHMGNRTKYTSSDLKRSAFKNIK* |
| Ga0102812_100432811 | 3300009086 | Estuarine | TIMDDTAKNLQKSENLFKLNNSPFRHMGKSFYKNDQGFKRSPFKHFK* |
| Ga0118736_100377412 | 3300009135 | Marine Sediment | IKDEAAKNLEKSENLFKLNRSPFTHMGNKRGAFKRSAFKNIK* |
| Ga0114918_101190641 | 3300009149 | Deep Subsurface | AKNLQKSENLFKLNKSPFKHMGHKSTTINSGFKKSAFKNIK* |
| Ga0105102_102626851 | 3300009165 | Freshwater Sediment | MDDAAKNLQKSENLFKLNSSPFRHVGKTHYDRGQGVKRSPFKNLK* |
| Ga0105097_100922411 | 3300009169 | Freshwater Sediment | TIMDDVAKNLQKSENLFKLNKSLFRHMGSGQLANGQSFKKSPFKNIK* |
| Ga0105096_103149481 | 3300009170 | Freshwater Sediment | NLFKLNSSPFRHMGSTRGLTNGSVFKKSPFKNIK* |
| Ga0115008_101439372 | 3300009436 | Marine | QKSDNLFKLNSSPFRHLGKKSRQINGRSFKKSAFKNIK* |
| Ga0129351_100037320 | 3300010300 | Freshwater To Marine Saline Gradient | DTAKKLQKSENLFKLNSTPFRHMGRKNKRNNGRTKRSAFKNIK* |
| Ga0129333_109001141 | 3300010354 | Freshwater To Marine Saline Gradient | KNLQKSENLFKLNNSPFRHMGRGQLGIGQNVKRSPFKNFK* |
| Ga0129333_114903191 | 3300010354 | Freshwater To Marine Saline Gradient | SENLFKLNKSLFRHMGSGQLANGQSFKKSPFKNIK* |
| Ga0129336_100301313 | 3300010370 | Freshwater To Marine Saline Gradient | SKNLQKSENLFKLNNSPFRHMGRGQLGIGQNVKRSPFKNFK* |
| Ga0114922_116450612 | 3300011118 | Deep Subsurface | AKQVIRDDAAKKLQKSENLFKLNSSPFTHMGRKNKTSRGRGFKKSAFKNIK* |
| Ga0157203_10587002 | 3300012663 | Freshwater | KRVIMDDTAKNLQKSENLFKLNRSPFRHMGGSGKSAVEGFKRSAFKNIK* |
| Ga0177922_103306391 | 3300013372 | Freshwater | IMDDAAKNLQKSENLFKLNSSPFRHMGRTSGSSSGGQNVKRSPFKNIK* |
| Ga0181338_10024631 | 3300015050 | Freshwater Lake | ASKNLQKSENLFKLNSSPFRHMGGNRAKVNGQYIKRSAFKNFK* |
| Ga0181344_10876732 | 3300017754 | Freshwater Lake | QKSENLFKLNRSPFRHMGGSGNSLAKGITRSPFKNIK |
| Ga0181409_11086361 | 3300017758 | Seawater | KQIIRDDAAKKLQKSENLFKFNSSPFTHMGRKRKKINGKSAKRSAFKNIK |
| Ga0181356_10380771 | 3300017761 | Freshwater Lake | RTIMDETAKNLQKSENLFKLNSSPFRHMGKTAYDKGQGVKRSPFKNIK |
| Ga0181357_10321072 | 3300017777 | Freshwater Lake | SENLFKLNSSPFRHIGGRSNLINGQTFKKSAFKNIK |
| Ga0181346_10473541 | 3300017780 | Freshwater Lake | RTIMDDAAKNLQKSENLFKLNSSPFRHMGSTRGLTNGSVFKKSPFKNIK |
| Ga0181355_13421601 | 3300017785 | Freshwater Lake | LQKSENLFKLNKSPFKHMGNKMMNSSGGFKRSAFKNIK |
| Ga0181592_110077721 | 3300018421 | Salt Marsh | RTILDDQAKKLQKSDNLFKLNSSPFRNIGNKRTKIGGKSYKRSPFKHFK |
| Ga0194029_10240102 | 3300019751 | Freshwater | AKNLQKSENLFKLNRSPFTHMGNKRGAFKRSAFKNIK |
| Ga0181359_12107002 | 3300019784 | Freshwater Lake | SRRTIMDETAKNLQKSENLFKLNKSPFRHMGSKMKNSVGGFKRSAFKNIK |
| Ga0194110_100399464 | 3300020084 | Freshwater Lake | QKSENFFKLNNSPFRHMGKSYYKGMQGVKRSPFKNFK |
| Ga0211736_108660232 | 3300020151 | Freshwater | MDDAAKNLQKSENLFKLNRSPFRHMGRGQLANGQKHKRSPFKNLK |
| Ga0194115_103241272 | 3300020183 | Freshwater Lake | LQKSENFFKLNNSPFRHMGKSYYKGMQGVKRSPFKNFK |
| Ga0208720_10111791 | 3300020495 | Freshwater | MDDAAKNLQKSENLFKLNSSPFRHVGKTHYDRGQGVKRSPFKNIK |
| Ga0212021_10453622 | 3300022068 | Aqueous | SNRGYTKQIIRDDAAKKLQKSENLFKLNSSPFRYMGRKSKRSKGRGFKKSAFKNIK |
| Ga0212119_10502042 | 3300022543 | Freshwater | IMDDAAKNLQKSDNLFKLPHSPFRHMGNGMRSGGQVIKRSPFKNFK |
| Ga0228675_11075962 | 3300024247 | Seawater | KRVVHDEASKNLQKSENLYKLNKSPFKHMGSAKGLNKQGMKRSAFKNLK |
| (restricted) Ga0255043_103049622 | 3300024338 | Seawater | AKKLQKSENLYKLKSSPFKHIGNKYNKFKSNSFKRSPFKNIK |
| (restricted) Ga0255046_100359321 | 3300024519 | Seawater | IRDDAAKKLQKSENLFKLNSSPFRYIGRKNKTSKGKGFKKSAFKNIK |
| (restricted) Ga0255044_102652351 | 3300024529 | Seawater | GYTKQIIRDDAAKKLQKSENLFKLNSSPFRHMGRNKTSRGRGFKKSAFKNIK |
| Ga0209535_12145392 | 3300025120 | Marine | KSENLFKLNSSPFRHMGRKGKRSKGKGFKRSAFKNIK |
| Ga0209634_10746552 | 3300025138 | Marine | DDSAKSLQKSENLYKLKSSPFRNMGNKRKKSKSNSFKRSPFKNIK |
| Ga0208899_12035781 | 3300025759 | Aqueous | AKKLQKSENLFKLNSSPFRHMSRKNNRLKGRGSKRSAFKNIK |
| Ga0209247_10104402 | 3300027468 | Freshwater Lake | ASKNLQKSENLFKLNKSPFRHMGGGSKVINGQVFKRSAFKNFK |
| Ga0209864_10161791 | 3300027547 | Sand | MDDSAKNLQKSENLFKLNRSPFRHMGKGQLANGQGFKKSPFKNLK |
| Ga0208975_10083801 | 3300027659 | Freshwater Lentic | SENLFKLNKSPFRHIGNEVKNKMSGLKRSAFRNIK |
| Ga0209492_10043451 | 3300027721 | Freshwater Sediment | DDAAKNLQKSENLFKLNSSPFRHVGKTHYDRGQGVKRSPFKNIK |
| Ga0209379_102818022 | 3300027758 | Marine Sediment | AAKNLEKSENLFKLNRSPFTHMGNKRGAFKRSAFKNIK |
| Ga0209354_101000742 | 3300027808 | Freshwater Lake | NLQKSENLFKLNSSPFRHMGKTAYDKGQGVKRSPFKNIK |
| Ga0209354_104072582 | 3300027808 | Freshwater Lake | DDAAKNLQKSENLFKLNRSPFRHMGGNKISNRTDFKRSAFKNLK |
| Ga0209990_103661471 | 3300027816 | Freshwater Lake | VMDEASKNLQKSENLYKLNNSPFRHMGKSSTTMAKGLKRSPFKNIR |
| (restricted) Ga0255041_100029033 | 3300027837 | Seawater | TKQIIRDDAAKKLQKSENLFKLNSSPFRHMGRNKTSRGRGFKKSAFKNIK |
| (restricted) Ga0233415_100462042 | 3300027861 | Seawater | IIRDDAAKKLQKSENLFKLNSSPFTHMGRKNKRMKGKNRKRSAFKNIK |
| Ga0209820_10592291 | 3300027956 | Freshwater Sediment | KDIIMDDASKNLQKSENLYKLSHNPFRHMGKGRNVMGQSFKRSAFKNFK |
| (restricted) Ga0233413_100634832 | 3300027996 | Seawater | IRDDAAKKLQKSENLFKLNSSPFRHMGRNKTSRGRGFKKSAFKNIK |
| (restricted) Ga0233413_105231611 | 3300027996 | Seawater | NRGYAKQVIRDDAAKKLQKSENLFKLNSSPFTHMGRKRKKINGKSAKRSAFKNIK |
| (restricted) Ga0233414_100075124 | 3300028045 | Seawater | IRDDAAKKLQKSENLFKLNSSPFTHIGNKYNKFKSNSFKRSPFKNIK |
| Ga0233401_10114412 | 3300028127 | Seawater | QKRVVHDEASKNLQKSENLYKLNKSPFKHMGSAKGLNKQGMKRSAFKNLK |
| Ga0256411_10349391 | 3300028134 | Seawater | QKSENLYKLNKSPFKHMGSAKGLNKQRMKRSAFKNLK |
| Ga0307380_100297224 | 3300031539 | Soil | MDDASKNLQKSENLFKLNRTPFRHMGGSSKVVNGQVFKRSAFRNLK |
| Ga0307376_108914871 | 3300031578 | Soil | DAAKNLQKSENLFKLNRSPFRHMGGNKISNRTDSKRSAFKNLK |
| Ga0307375_103216102 | 3300031669 | Soil | AAKNLQKSENLFKLNKSPFRHIGSSSKSTDKGFRRSAFKNFK |
| Ga0307375_108217851 | 3300031669 | Soil | IMDDASKNLQKSENLFKLNRSPFRHMGQGKGSLSGGMHRSPFKNIK |
| Ga0307377_102289322 | 3300031673 | Soil | KNLQKSENLFKLNKGLFRHMGNKSLNRDNGFKKSAFKNIK |
| Ga0315322_106730671 | 3300031766 | Seawater | TAKKLQKSENLYKLKSSPFRHVGNKYKKFKSNSIKRSPFKNIKK |
| Ga0315900_103805973 | 3300031787 | Freshwater | SKNLQKSENLYKLSHTPFRHMGKGRNVMGQSFKRSAFKNFK |
| Ga0315290_111953042 | 3300031834 | Sediment | IMDDAAKNLQKSENLFKLNRSPFRHMGGNKISNRTDSKRSAFKNLK |
| Ga0315904_112730222 | 3300031951 | Freshwater | NLQKSENLFKLNKSPFRHMGNGMKSTRGGLRRSAFKNIK |
| Ga0315901_102179701 | 3300031963 | Freshwater | RTIMDDTAKNLQKSENLFKLNKSPFRHMGNGMKSTRGGLRRSAFKNIK |
| Ga0315903_102880001 | 3300032116 | Freshwater | AKNLQKSDNLFKLSMSPFRHMGKSRLSNGQGFKKSPFKNFK |
| Ga0315903_105457812 | 3300032116 | Freshwater | KSENLFKLNKSPFRHMGNGIKNTMGGFRKSAFKNFK |
| Ga0316627_1026345572 | 3300033482 | Soil | KSENSFKLNKSPFRHMGSKMSNTTGRFKKSAFKNIK |
| Ga0334996_0032304_3156_3296 | 3300033994 | Freshwater | MDDASKNLQKSNNLFKLNRTPFRHMGQGSKVINGQVFNKSAFKNFK |
| Ga0334996_0274296_28_165 | 3300033994 | Freshwater | MDDVAKNLQKSENLFKLNKSPFRHMGGSGNSLSKGITRSPFKNIK |
| Ga0334985_0140033_33_170 | 3300034018 | Freshwater | MDDAAKNLQKSENLFKLNRSPFRHMGRGQLGNGQNFKRSPFKNIK |
| Ga0334987_0139582_2_139 | 3300034061 | Freshwater | MDDAAKNLQKSENLFKLNNSPFRHMGKSYYKGMQGVKRSPFKNFK |
| Ga0335066_0641893_1_135 | 3300034112 | Freshwater | DDAAKNLQKSENLFKLNKSPFKHMGNKMMNSSGGFKRSAFKNIK |
| Ga0335068_0270011_38_175 | 3300034116 | Freshwater | MDDVAKNLQKSENFSKLNRSPFRHMGGSGNSLSKGITRSPFKNIK |
| Ga0335052_0034511_2993_3151 | 3300034279 | Freshwater | ESNRGFLKRYITDDTVKNLQKSDNLFKLNKSPFRNMGKNSQGIRRSAFKNIK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |