3300002741: Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL

Overview

Basic Information

• IMG/M Taxon OID: 3300002741
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053073 | Gp0061144 | Ga0007024
• Sample Name: Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 118510143
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas crusticola	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations
• Type: Host-Associated
• Taxonomy: Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere

Location Information

• Location: University of North Carolina, USA
• Coordinates
  • Lat. (^o): 35.9082
  • Long. (^o): -79.0499
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080973	Metagenome	114	Y
F096514	Metagenome / Metatranscriptome	104	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI25157J39369_1018730	Not Available	833
JGI25157J39369_1024897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas crusticola	700

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI25157J39369_1018730	JGI25157J39369_10187301	F080973	MVLPTALQVAFPTQGDVREMIAGAIGELTGTPAAEVDLGASRVLVLTDTRGGYNWSYPDAMVKARFRPFVHRAVSMVRQQYPILR*
JGI25157J39369_1024897	JGI25157J39369_10248971	F096514	MDLIDLYHRRGIALVRSKLRTSAAARRGYGRLARLYSEQIERQRALLPNSPGFTPAL*