3300002685: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_200m_A (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300002685
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0046785 | Gp0055329 | Ga0005237
• Sample Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_200m_A (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 28981149
• Sequencing Scaffolds: 4
• Novel Protein Genes: 4
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales	1
All Organisms → cellular organisms → Archaea	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → coastal inlet → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: British Columbia, Canada
• Coordinates
  • Lat. (^o): 48.7299
  • Long. (^o): -123.5699
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034189	Metagenome / Metatranscriptome	175	Y
F090440	Metagenome / Metatranscriptome	108	N
F099485	Metagenome / Metatranscriptome	103	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0005237J37283_1001748	Not Available	552
Ga0005237J37283_1002621	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales	790
Ga0005237J37283_1003324	All Organisms → cellular organisms → Archaea	759
Ga0005237J37283_1029984	Not Available	530

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0005237J37283_1001748	Ga0005237J37283_10017481	F090440	GGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG*
Ga0005237J37283_1002621	Ga0005237J37283_10026211	F099485	IVHNWQHSPSEIQVARTPVKAVSKSLQQTKPSVFSVEDLMGLSWILFEERH*
Ga0005237J37283_1003324	Ga0005237J37283_10033241	F099485	IRNWQHSPSKTQVASTPVKAVSKSLQQSQTFTHEDLMGLSWMLSEEGD*
Ga0005237J37283_1029984	Ga0005237J37283_10299841	F034189	MTTNLAKWASNDGQITKSGLPNDRRAKFLPSVVGFAYDLLRYEYYLGNI