Basic Information | |
---|---|
IMG/M Taxon OID | 3300002685 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046785 | Gp0055329 | Ga0005237 |
Sample Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_200m_A (Metagenome Metatranscriptome) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 28981149 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales | 1 |
All Organisms → cellular organisms → Archaea | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → coastal inlet → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | British Columbia, Canada | |||||||
Coordinates | Lat. (o) | 48.7299 | Long. (o) | -123.5699 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F034189 | Metagenome / Metatranscriptome | 175 | Y |
F090440 | Metagenome / Metatranscriptome | 108 | N |
F099485 | Metagenome / Metatranscriptome | 103 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0005237J37283_1001748 | Not Available | 552 | Open in IMG/M |
Ga0005237J37283_1002621 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales | 790 | Open in IMG/M |
Ga0005237J37283_1003324 | All Organisms → cellular organisms → Archaea | 759 | Open in IMG/M |
Ga0005237J37283_1029984 | Not Available | 530 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0005237J37283_1001748 | Ga0005237J37283_10017481 | F090440 | GGNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG* |
Ga0005237J37283_1002621 | Ga0005237J37283_10026211 | F099485 | IVHNWQHSPSEIQVARTPVKAVSKSLQQTKPSVFSVEDLMGLSWILFEERH* |
Ga0005237J37283_1003324 | Ga0005237J37283_10033241 | F099485 | IRNWQHSPSKTQVASTPVKAVSKSLQQSQTFTHEDLMGLSWMLSEEGD* |
Ga0005237J37283_1029984 | Ga0005237J37283_10299841 | F034189 | MTTNLAKWASNDGQITKSGLPNDRRAKFLPSVVGFAYDLLRYEYYLGNI |
⦗Top⦘ |