NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002117

3300002117: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A2-10



Overview

Basic Information
IMG/M Taxon OID3300002117 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0056003 | Ga0004427
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A2-10
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size4313299
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldagricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.2958Long. (o)-89.3799Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038480Metagenome166Y
F054841Metagenome / Metatranscriptome139Y
F098176Metagenome104N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI24233J26641_100008Not Available1497Open in IMG/M
JGI24233J26641_100682Not Available516Open in IMG/M
JGI24233J26641_100687Not Available515Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI24233J26641_100008JGI24233J26641_1000081F098176MRPGLVASYRNTSETLVPRGRKRNRMYLGLLRADLLENDGTIIAGDATAVRSAMNELNTALEGITDADPIFAPQGLAIVSPTAGECYEVNEVGCGEAVDTHRSRRQKEPENMIWQAAS*
JGI24233J26641_100682JGI24233J26641_1006821F038480KPNMEGACRVVADRGSSQMKLGRKSGKIVRRDTMKAILVSIVLYFAATAAHSMPISVLNANGLSATIPISDQCGDRCGSSRSYVKDRRSGVGGYSGGYVLVRDPLIQRRPFCPFGSYVACVVSGTYCVDLCH*
JGI24233J26641_100687JGI24233J26641_1006871F054841MQIQVTSIRRRSNGTVDMDVYRRKAFLLRRETTNQILRRLGRSVLPRLIGAIAILVSYVLFLPRNPLPQGAGSTFAPAK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.