3300002023: Switchgrass rhizosphere and bulk soil microbial communities from Knoxville, Tennessee, USA - plot21A

Overview

Basic Information

• IMG/M Taxon OID: 3300002023
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0103013 | Gp0060270 | Ga0016925
• Sample Name: Switchgrass rhizosphere and bulk soil microbial communities from Knoxville, Tennessee, USA - plot21A
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 32980114
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Knoxville, Tennessee, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Clay → Grasslands → Switchgrass Rhizosphere And Bulk Soil → Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Knoxville, Tennessee, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): grassland biome → land → bulk soil
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere

Location Information

• Location: Knoxville, Tennessee, USA
• Coordinates
  • Lat. (^o): 35.9728
  • Long. (^o): -83.9422
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046519	Metagenome / Metatranscriptome	151	Y
F059695	Metagenome / Metatranscriptome	133	N

Associated Scaffolds

Scaffold	Taxonomy	Length
plot21A_1008755	Not Available	516
plot21A_1016703	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b	503

Sequences

Scaffold ID	Protein ID	Family	Sequence
plot21A_1008755	plot21A_10087552	F059695	VLARLKGPFDVVPQLAYSKTIAKSDKKPSRHFIRSEAFVNEKVIYRKGPSNRANKVLEVGLWVSYIFGLKQKI*
plot21A_1016703	plot21A_10167032	F046519	EEQRVTSGELTGSPGGTGVSRPISGGEVASDALSVVGPLRGT*