3300001438: Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5

Overview

Basic Information

• IMG/M Taxon OID: 3300001438
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0090294 | Gp0057738 | Ga0012465
• Sample Name: Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 3208132
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere

Location Information

• Location: Kellogg Biological Station, Michigan, USA
• Coordinates
  • Lat. (^o): 42.3948
  • Long. (^o): -85.3738
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004014	Metagenome / Metatranscriptome	457	Y
F070666	Metagenome / Metatranscriptome	123	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI24035J14997_100077	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	748
JGI24035J14997_100120	Not Available	654

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI24035J14997_100077	JGI24035J14997_1000772	F004014	MRKAHLCGCAVLLLFCAPSFAQENSRSGSAKEDAPKVIATDDMKLAMKAGKLETAGKYDEALKVYAQAIDLKGRFTPFVYHNRGMLYLQRAKAAQDRQSRIADLQHAIDDFQTSIRLGAASKEELN
JGI24035J14997_100120	JGI24035J14997_1001201	F070666	VVFPRISSIFDPQAIFSVELLPGGGQAHHKMDCILTPAFIGSRCRIRGARQHPAAIHLTVEAST