| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001329 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0083722 | Gp0054896 | Ga0011036 |
| Sample Name | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A28-5cm)- 6 month illumina |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Tennessee |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 31976169 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars) |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → active permafrost layer → permafrost |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Axel Heiberg Island, Nunavut, Canada | |||||||
| Coordinates | Lat. (o) | 79.26 | Long. (o) | -90.46 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002094 | Metagenome / Metatranscriptome | 594 | Y |
| F016071 | Metagenome / Metatranscriptome | 250 | Y |
| F025332 | Metagenome / Metatranscriptome | 202 | Y |
| F084617 | Metagenome / Metatranscriptome | 112 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| A285W6_1040332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 561 | Open in IMG/M |
| A285W6_1040800 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| A285W6_1044410 | Not Available | 556 | Open in IMG/M |
| A285W6_1091297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| A285W6_1040332 | A285W6_10403322 | F016071 | MPHQIERKFAFGPSALDDLARAFDSAWKELSAQGVEMNSEEQLRCIRTKLAQRIMEYATEGEHGVGHLKEFGLQGLPHL |
| A285W6_1040800 | A285W6_10408002 | F084617 | VAVIEPGDASKREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIMAVAVIVVILYLLGR* |
| A285W6_1044410 | A285W6_10444102 | F025332 | MIRELAFASKQGMTAETLLWRGVIAVTIQDWLSKPLRPKREAERYLFENSADLSLVCSSAGIDVGQLRERLNKVRGRTLLDLLPVAA* |
| A285W6_1091297 | A285W6_10912971 | F002094 | PTGDLGTVERSNEEDAVVKWDDDGRMRLRQRSLKKI* |
| ⦗Top⦘ |