| Basic Information | |
|---|---|
| Family ID | F084617 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 49 residues |
| Representative Sequence | EKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIGAIAVIVVILYLLGR |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.18 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.214 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.750 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.321 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.69% β-sheet: 0.00% Coil/Unstructured: 65.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF01458 | SUFBD | 62.50 |
| PF05635 | 23S_rRNA_IVP | 19.64 |
| PF00266 | Aminotran_5 | 1.79 |
| PF08327 | AHSA1 | 1.79 |
| PF00005 | ABC_tran | 1.79 |
| PF02541 | Ppx-GppA | 0.89 |
| PF00903 | Glyoxalase | 0.89 |
| PF11954 | DUF3471 | 0.89 |
| PF12840 | HTH_20 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 62.50 |
| COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 1.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.21 % |
| Unclassified | root | N/A | 1.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000878|AL9A1W_1234907 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 514 | Open in IMG/M |
| 3300000887|AL16A1W_10099423 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 2720 | Open in IMG/M |
| 3300001329|A285W6_1040800 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300001536|A1565W1_10479583 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300001538|A10PFW1_12339196 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300001664|P5cmW16_1052070 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300001686|C688J18823_10976781 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 537 | Open in IMG/M |
| 3300004114|Ga0062593_102031903 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300004153|Ga0063455_100929798 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300004156|Ga0062589_101771927 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300004479|Ga0062595_101999742 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300004480|Ga0062592_101552062 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 638 | Open in IMG/M |
| 3300004480|Ga0062592_102078105 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 563 | Open in IMG/M |
| 3300005093|Ga0062594_100928506 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 826 | Open in IMG/M |
| 3300005181|Ga0066678_10716066 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 666 | Open in IMG/M |
| 3300005328|Ga0070676_11253531 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 565 | Open in IMG/M |
| 3300005328|Ga0070676_11530517 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005341|Ga0070691_10818280 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 569 | Open in IMG/M |
| 3300005344|Ga0070661_101317282 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005364|Ga0070673_100822401 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 859 | Open in IMG/M |
| 3300005439|Ga0070711_101944119 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005444|Ga0070694_101216767 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 631 | Open in IMG/M |
| 3300005454|Ga0066687_10547314 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 687 | Open in IMG/M |
| 3300005455|Ga0070663_101025394 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 718 | Open in IMG/M |
| 3300005457|Ga0070662_101386406 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 605 | Open in IMG/M |
| 3300005459|Ga0068867_100079087 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
| 3300005518|Ga0070699_100037937 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4171 | Open in IMG/M |
| 3300005536|Ga0070697_100166111 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1866 | Open in IMG/M |
| 3300005545|Ga0070695_100753249 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 777 | Open in IMG/M |
| 3300005546|Ga0070696_100713338 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 819 | Open in IMG/M |
| 3300006031|Ga0066651_10511376 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300006046|Ga0066652_101677978 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 580 | Open in IMG/M |
| 3300006173|Ga0070716_100840848 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 714 | Open in IMG/M |
| 3300006173|Ga0070716_101657517 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 527 | Open in IMG/M |
| 3300006794|Ga0066658_10230637 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300006800|Ga0066660_11698061 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 503 | Open in IMG/M |
| 3300006845|Ga0075421_102302132 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006876|Ga0079217_10392685 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300006881|Ga0068865_101278736 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 652 | Open in IMG/M |
| 3300006914|Ga0075436_101233294 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 565 | Open in IMG/M |
| 3300006950|Ga0075524_10106275 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300009098|Ga0105245_11114284 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 836 | Open in IMG/M |
| 3300009137|Ga0066709_102777487 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300009143|Ga0099792_10532910 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010039|Ga0126309_10040289 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2184 | Open in IMG/M |
| 3300010039|Ga0126309_10951861 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300010397|Ga0134124_10837072 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300011444|Ga0137463_1310883 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300012003|Ga0120163_1103172 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012004|Ga0120134_1040019 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300012019|Ga0120139_1145177 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 616 | Open in IMG/M |
| 3300012091|Ga0136625_1019632 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2507 | Open in IMG/M |
| 3300012356|Ga0137371_10565320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
| 3300012668|Ga0157216_10390607 | Not Available | 618 | Open in IMG/M |
| 3300012681|Ga0136613_10193662 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1149 | Open in IMG/M |
| 3300012927|Ga0137416_11654887 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012944|Ga0137410_10199642 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1548 | Open in IMG/M |
| 3300012957|Ga0164303_11010674 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300012987|Ga0164307_11623091 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012989|Ga0164305_11120773 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300013764|Ga0120111_1010103 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2937 | Open in IMG/M |
| 3300013772|Ga0120158_10523152 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 516 | Open in IMG/M |
| 3300014166|Ga0134079_10696906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 517 | Open in IMG/M |
| 3300015079|Ga0167657_1032302 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300015199|Ga0167647_1114042 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300015264|Ga0137403_11191027 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 608 | Open in IMG/M |
| 3300015356|Ga0134073_10218696 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300015371|Ga0132258_10304470 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3921 | Open in IMG/M |
| 3300017997|Ga0184610_1223966 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300018027|Ga0184605_10331591 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300018061|Ga0184619_10432573 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300018076|Ga0184609_10037213 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
| 3300018482|Ga0066669_10665601 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300019865|Ga0193748_1020000 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300019887|Ga0193729_1163658 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300020022|Ga0193733_1075347 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300020060|Ga0193717_1193843 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300021344|Ga0193719_10103208 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300021411|Ga0193709_1050135 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300021412|Ga0193736_1000284 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6166 | Open in IMG/M |
| 3300021976|Ga0193742_1196333 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300022694|Ga0222623_10226263 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300022756|Ga0222622_10134176 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales | 1575 | Open in IMG/M |
| 3300022756|Ga0222622_10292244 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300024245|Ga0247677_1055717 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300025481|Ga0208079_1018231 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2186 | Open in IMG/M |
| 3300025906|Ga0207699_10706313 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300025907|Ga0207645_10943240 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 586 | Open in IMG/M |
| 3300025910|Ga0207684_10619753 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 923 | Open in IMG/M |
| 3300025929|Ga0207664_11157571 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300025939|Ga0207665_11225757 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 599 | Open in IMG/M |
| 3300025972|Ga0207668_10791121 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 839 | Open in IMG/M |
| 3300025981|Ga0207640_10621037 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300025981|Ga0207640_11454574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 615 | Open in IMG/M |
| 3300026067|Ga0207678_11251658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300026142|Ga0207698_12560712 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300026313|Ga0209761_1149366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1103 | Open in IMG/M |
| 3300027645|Ga0209117_1092840 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300027674|Ga0209118_1003063 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6902 | Open in IMG/M |
| 3300027678|Ga0209011_1097040 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300027876|Ga0209974_10047999 | Not Available | 1431 | Open in IMG/M |
| 3300028715|Ga0307313_10265143 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300028719|Ga0307301_10299359 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300028784|Ga0307282_10183028 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 999 | Open in IMG/M |
| 3300028784|Ga0307282_10214375 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300028784|Ga0307282_10281460 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300028784|Ga0307282_10509329 | All Organisms → cellular organisms → Bacteria → FCB group | 584 | Open in IMG/M |
| 3300028884|Ga0307308_10522924 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300028885|Ga0307304_10347443 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031058|Ga0308189_10370118 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300033412|Ga0310810_11217757 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300034125|Ga0370484_0113543 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.71% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 9.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.46% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.68% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.68% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.79% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.79% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000878 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001329 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A28-5cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015079 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
| 3300021976 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AL9A1W_12349072 | 3300000878 | Permafrost | AGASKREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIMAVAVIVVILYLLGR* |
| AL16A1W_100994233 | 3300000887 | Permafrost | VIEPAGASKREKDISTRRNTIKHPILAGDLDPDSPRRVPTNVIVMAVLVIVIILYLLGR* |
| A285W6_10408002 | 3300001329 | Permafrost | VAVIEPGDASKREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIMAVAVIVVILYLLGR* |
| A1565W1_104795831 | 3300001536 | Permafrost | RRNTIKHPILAGDLDPDSPRRVPTNVIVMAVLVIVIILYLLGR* |
| A10PFW1_123391961 | 3300001538 | Permafrost | IEPAGASKREKDISTRRNTIKHPILAGDLDPDSPRKIPTNVILMAVMVIVVILYLLGR* |
| P5cmW16_10520701 | 3300001664 | Permafrost | ILAGDLDPDSPRRVPTNVIIMAVAVIVVILYLLGR* |
| C688J18823_109767812 | 3300001686 | Soil | ILAGDLDPDSPRSVPTNVIIGAIAVIIVILYLLGR* |
| Ga0062593_1020319031 | 3300004114 | Soil | PLGVAVIEPVGASKREKDINTRRNTIKHPILAGDLDPDQPRKVPTNVIVMAVMVIVVILYLLGR* |
| Ga0063455_1009297981 | 3300004153 | Soil | PASATKREKDISTRRNTIKHPILAGDLDPDSPNKVPTNIIVGAIAVIVVILYLLGR* |
| Ga0062589_1017719272 | 3300004156 | Soil | RRNTIKHPILAGDLDPDQPRKVPTNVIVMAVMVIVVILYLLGR* |
| Ga0062595_1019997421 | 3300004479 | Soil | KREKDINTRRNTIKHPILAGDLDPDSPRSVPTNVIIGAIAVIVVILYLLGR* |
| Ga0062592_1015520622 | 3300004480 | Soil | ATKREKDISTRRNTIKHPILAGDLDPDSPRRVPTNAIIGAITVIVVILYLLGR* |
| Ga0062592_1020781051 | 3300004480 | Soil | GVAVIEPAAATKREKDISTRRNTIKHPILAGDLDPDSPNKVPTNVIVGAIAVIVVILYLLGR* |
| Ga0062594_1009285061 | 3300005093 | Soil | GVAVIEPASATKREKDISTRRNTIKHPILASDLDPDSPRKVPTNVIIGAIAVIVVILYLLGR* |
| Ga0066678_107160662 | 3300005181 | Soil | EPATASKREKDIGTRRNTIKHPILAGDLDPDSPRKVPTNIIIGAITVIVVILYLLGR* |
| Ga0070676_112535312 | 3300005328 | Miscanthus Rhizosphere | EPAAATKREKDISTRRNTIKHPILAGDLDPDSPNKVPTNVIVGAIAVIVVILYLLGR* |
| Ga0070676_115305171 | 3300005328 | Miscanthus Rhizosphere | DISTRRNTIKHPILASDLDPDSPRSVPTNVIIGAIAVIVVILYLLGR* |
| Ga0070691_108182802 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | GVAVIEPSAATKREKDISTRRNTIKHPILAGDLDPDSPRRVPTNVIIGAITVIVVILYLLGR* |
| Ga0070661_1013172821 | 3300005344 | Corn Rhizosphere | SASKREKDINTRRNTIKHPILAGDLDPDQPRKVPTNVIVMAVMVIVVILYLLGR* |
| Ga0070673_1008224012 | 3300005364 | Switchgrass Rhizosphere | RNTIKHPILASDLDPDSPRKVPTNVIIGAIGVIVVILYLLGR* |
| Ga0070711_1019441192 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EPAGASKREKDINTRRNTIKHPILAGDLDPDSPRSVPTNVIIGAIAVIIVILYLLGR* |
| Ga0070694_1012167672 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GVAVIEPAAATKREKDISTRRNTIKHPILAGDLDPDSPRKVPTNVIIGAIAVIIVILYLLGR* |
| Ga0066687_105473142 | 3300005454 | Soil | VAVIEPAAASKREKDISTRRNTIKHPILAGDLDPDSPRKVPTNVIIGAIAVIIVILYLLGR* |
| Ga0070663_1010253942 | 3300005455 | Corn Rhizosphere | REKDISTRRNTIKHPILASDLDPDSPRKVPTNVIIGAIAVIVVILYLLGR* |
| Ga0070662_1013864061 | 3300005457 | Corn Rhizosphere | IKHPILAGDLDPDSPRRVPTNVIIGAITVIVVILYLLGR* |
| Ga0068867_1000790874 | 3300005459 | Miscanthus Rhizosphere | VAVIEPASATKREKDISTRRNTIKHPILASDLDPDSPRKVPTNVIIGAIAVIVVILYLLGR* |
| Ga0070699_1000379371 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TRRNTIKHPILAGDLDPDSPRRVPTNVIIGAIAVIVVILYLLGR* |
| Ga0070697_1001661111 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIGAIAVIVVILYLLGR* |
| Ga0070695_1007532491 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | NTIKHPILAGDLDPDSPRRVPTNAIIGAITVIVVILYLLGR* |
| Ga0070696_1007133381 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | DISTRRNTIKHPILASDLDPDSPRKVPTNVIIGAIAVIVVILYLLGR* |
| Ga0066651_105113762 | 3300006031 | Soil | REKDISTRRNTIKHPILAGDLDPDSPRKVPTNVIIGAIAVIIVILYLLGR* |
| Ga0066652_1016779782 | 3300006046 | Soil | PLGVAVIEPATASKREKDISTRRNTIKHPILAGDLDPDSPRKVPTNIIIGAIAVIVIILYLLGR* |
| Ga0070716_1008408482 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PILAGDLDPDSPRKVPTNVIIGAIAVIIVILYLLGR* |
| Ga0070716_1016575172 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ASKREKDISTRRNTIKHPILAGDLDPDSPRKVPTNVIIGAIAVIVVILYLLGR* |
| Ga0066658_102306373 | 3300006794 | Soil | NTIKHPILAGDLDPDSPRKVPTNVIIGAIAVIVVILYLLGR* |
| Ga0066660_116980612 | 3300006800 | Soil | LAGDLDPDSPRKVPTNVIIGAIAVIIVILYLLGR* |
| Ga0075421_1023021322 | 3300006845 | Populus Rhizosphere | KREKDISTRRNTIKHPILASDLDPDSPRKVPTNVIIGAIAVIVVILYLLGR* |
| Ga0079217_103926851 | 3300006876 | Agricultural Soil | RRNTIKHPIMAGTLDPDSPRRVPKNVIVMAVMVIVVILYLLGR* |
| Ga0068865_1012787362 | 3300006881 | Miscanthus Rhizosphere | RRNTIKHPILASDLDPDSPRKVPTNVIIGAIAVIVVILYLLGR* |
| Ga0075436_1012332941 | 3300006914 | Populus Rhizosphere | TATKREKDISTRRNTIKHPILASDLDPDSPRRVPTNVIIGAIAVIVVILYLLGR* |
| Ga0075524_101062752 | 3300006950 | Arctic Peat Soil | AGASKREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIGAIAVIVVILYLLGR* |
| Ga0105245_111142841 | 3300009098 | Miscanthus Rhizosphere | KHPILAGDLDPDSPRRVPTNAIIGAITVIVVILYLLGR* |
| Ga0066709_1027774872 | 3300009137 | Grasslands Soil | RLPRRVAVIEPAAASKPEKDLSTRRNTIKHPIMAGDLDPDSPNKVPTNVIVGAIAVIVVILYLLGK* |
| Ga0099792_105329101 | 3300009143 | Vadose Zone Soil | NTRRNTIKHPILAGDLDPDSPRKIPTNVIVMAVMVIVVILYLLGR* |
| Ga0126309_100402891 | 3300010039 | Serpentine Soil | PILAGDLDPDSPRKVPTNVIIMAVMVIVVILYLLGR* |
| Ga0126309_109518611 | 3300010039 | Serpentine Soil | RNTIKHPILAGDLDPDSPRKVPTNVIILSVMVIVVILYLLGR* |
| Ga0134124_108370721 | 3300010397 | Terrestrial Soil | PAGASKREKDISTRRNTIKHPILASDLDPDSPRSVPTNVIIGAIAVIVVILYLLGR* |
| Ga0137463_13108831 | 3300011444 | Soil | INTRRNTIKHPILAGDLDPDSPRRVPTNIIIGAIAVIVVILYLLGR* |
| Ga0120163_11031722 | 3300012003 | Permafrost | NTIKHPILAGDLDPDSPRRVPTNVIIGAIAVIIVILYLLGR* |
| Ga0120134_10400191 | 3300012004 | Permafrost | KREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIMAVAVIVVILYLLGR* |
| Ga0120139_11451771 | 3300012019 | Permafrost | VIEPAGASKREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIISVMVIVVVLYLLGR* |
| Ga0136625_10196321 | 3300012091 | Polar Desert Sand | AAKREKDIGTRRNTIKHPIMAGTLDPDAPQKIPTNVIVMAVMVIVVILYLLGR* |
| Ga0137371_105653201 | 3300012356 | Vadose Zone Soil | STRRNTIKHPIMAGDLDPDSPNKVPTNIIVGAIAVIVVILYLLGR* |
| Ga0157216_103906071 | 3300012668 | Glacier Forefield Soil | MAGNLVPDAPRKVPKNVIIMAIMVIVVILYLLGR* |
| Ga0136613_101936621 | 3300012681 | Polar Desert Sand | TIKHPIMAGTLDPDAPQKIPTNVIVMAVMVIVVILYLLGR* |
| Ga0137416_116548871 | 3300012927 | Vadose Zone Soil | LGVAVIEPAGASKREKDINSRRNTIKHPILAGDLDPDSPRRVPTNVIIGAVMVIILILYLLGR* |
| Ga0137410_101996421 | 3300012944 | Vadose Zone Soil | NTRRNTIKHPILAGDLDPDSPRRVPTNVIIGAIAVIVVILYLLGR* |
| Ga0164303_110106741 | 3300012957 | Soil | TIKHPILASDLDPDSPRRVPTNIIIGAIAVIVVILYLLGR* |
| Ga0164307_116230911 | 3300012987 | Soil | RRNTIKHPILASDLDPDSPRRVPTNVIVGAIMVIVTILSLLGR* |
| Ga0164305_111207731 | 3300012989 | Soil | PTSATKREKDISTRRNTIKHPILASDLDPDSPRRVPTNIIIGAIAVIVVILYLLGR* |
| Ga0120111_10101031 | 3300013764 | Permafrost | DINTRRNTIKHPILAGDLDPDSPRRVPTNVIVMAVMVIVVILYLLGR* |
| Ga0120158_105231522 | 3300013772 | Permafrost | FGVAVTEPAGASKREKDISPRRNTIKHPILAGDLDPDSPRRVPTNVIVMAVLVIVIILYLLGR* |
| Ga0134079_106969061 | 3300014166 | Grasslands Soil | KREKDISTRRNTIKHPILAGDLDPDSPRKVPTNIIIGAIAVIVIILYLLGR* |
| Ga0167657_10323022 | 3300015079 | Glacier Forefield Soil | PAGASKREKDISTRRNTIKHPILAGDLDPDSPRKIPTNVILMAVMVIVVILYLLGR* |
| Ga0167647_11140422 | 3300015199 | Glacier Forefield Soil | RRNTIKHPILAGDLDPDSPRKIPTNVIVMAVMVIVVILYLLGR* |
| Ga0137403_111910272 | 3300015264 | Vadose Zone Soil | ISTRRNTIKHPILAGDLDPDSPNRVPTNVIIGAIAVIVIILYLLGR* |
| Ga0134073_102186961 | 3300015356 | Grasslands Soil | NTIKHPILASDLDPDSPRTVPTNVIIGAIAVIVVILYLLGR* |
| Ga0132258_103044701 | 3300015371 | Arabidopsis Rhizosphere | STRRNTIKHPILASDLDPDSPRKVPTNVIIGAIAVIVVILYLLGR* |
| Ga0184610_12239662 | 3300017997 | Groundwater Sediment | KHPILAGDLDPDSPRRVPTKVIIMAVMVIVVILYLLGR |
| Ga0184605_103315911 | 3300018027 | Groundwater Sediment | ILAGDLDPDSPRRVPTNVIIGSVLVIILILYLLGR |
| Ga0184619_104325731 | 3300018061 | Groundwater Sediment | KREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIVMAVLVIVVILYLLGR |
| Ga0184609_100372133 | 3300018076 | Groundwater Sediment | EKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIVSVLVIVVILYLLGR |
| Ga0066669_106656011 | 3300018482 | Grasslands Soil | TRRNTIKHPILAGDLDPDSPRKVPTNIIIGAIAVIVIILYLLGR |
| Ga0193748_10200001 | 3300019865 | Soil | PAGASKREKDINSRRNTIKHPILAGDLDPDSPRRVPTNVIIGAVMVIILILYLLGR |
| Ga0193729_11636582 | 3300019887 | Soil | PAGASKREKDINTRRNTIKHPILAGDLDPDSPRRVPTNIIIGAIAVIVVILYLLGR |
| Ga0193733_10753472 | 3300020022 | Soil | RNTIKHPILAGDLDPDSPRRVPTNVIIMAVMVIIVILYLLGR |
| Ga0193717_11938432 | 3300020060 | Soil | TRRNTIKHPIMAGDLDPDSPRSVPTNVIIGAIAVIVVILYLLGR |
| Ga0193719_101032081 | 3300021344 | Soil | GASKREKDINTRRNTIKHPILAGDLDPDSPRSVPTNVIIGAIAVIVVILYLLGR |
| Ga0193709_10501352 | 3300021411 | Soil | RRNTIKHPILAGDLDPDSPRSVPTNVIIGAIAVIVVILYLLGR |
| Ga0193736_10002841 | 3300021412 | Soil | TRRNTIKHPILAGDLDPDSPRKVPTNVIIMSVMVIVVILYLLGR |
| Ga0193742_11963332 | 3300021976 | Soil | NTRRNTIKHPILAGDLDPDSPRRVPTNVIIGAIAVIIVILYLLGR |
| Ga0222623_102262631 | 3300022694 | Groundwater Sediment | DINTRRNTIKHPILAGDLDPDSPRRVPTNVIIMAVMVIIVILYLLGR |
| Ga0222622_101341762 | 3300022756 | Groundwater Sediment | TIKHPILAGDLDPDSPRRVPTNVIIMAVMVIVVILYLLGR |
| Ga0222622_102922442 | 3300022756 | Groundwater Sediment | SKREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIMAVMVIVVILYLLGR |
| Ga0247677_10557171 | 3300024245 | Soil | PAGASKREKDINTRRNTIKHPILAGDLDPDSPRSVPTNVIIGAIAVIVVILYLLGR |
| Ga0208079_10182313 | 3300025481 | Arctic Peat Soil | AGASKREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIGAIAVIVVILYLLGR |
| Ga0207699_107063131 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | RRNTIKHPILASDLDPDSPRRVPTNIIIGAIAVIVVILYLLGR |
| Ga0207645_109432402 | 3300025907 | Miscanthus Rhizosphere | VIEPAAATKREKDISTRRNTIKHPILAGDLDPDSPNKVPTNVIVGAIAVIVVILYLLGR |
| Ga0207684_106197532 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LGVAVIEPAGASKREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIGAIAVIVVILYLLGR |
| Ga0207664_111575711 | 3300025929 | Agricultural Soil | TRRNTIKHPILAGDLDPDSPRSVPTNVIIGAIAVIVVILYLLGR |
| Ga0207665_112257572 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | PILAGDLDPDSPRKVPTNVIIGAIAVIIVILYLLGR |
| Ga0207668_107911211 | 3300025972 | Switchgrass Rhizosphere | ISTRRNTIKHPILAGDLDPDSPRRVPTNAIIGAITVIVVILYLLGR |
| Ga0207640_106210371 | 3300025981 | Corn Rhizosphere | EPATATKREKDISTRRNTIKHPILASDLDPDSPRRVPTNVIIGAIAVIVVILYLLGR |
| Ga0207640_114545742 | 3300025981 | Corn Rhizosphere | EKDINTRRNTIKHPILAGDLDPDSPRKVPTNVIIGAIAVIIVILYLLGR |
| Ga0207678_112516581 | 3300026067 | Corn Rhizosphere | PILAGDLDPDQPRKVPTNVIIMAVMVIVVILYLLGR |
| Ga0207698_125607122 | 3300026142 | Corn Rhizosphere | KREKDINTRRNTIKHPILAGDLDPDSPRSVPTNVIIGAIAVIVVILYLLGR |
| Ga0209761_11493661 | 3300026313 | Grasslands Soil | LGVAVIEPATASKREKDIGTRRNTIKHPIMAGDLDPDSPNKVPTNIIVGAIAVIVVILYLLGR |
| Ga0209117_10928401 | 3300027645 | Forest Soil | RRNTIKHPILAGDLDPDSPRKVPTNVIIMAVMVIVVILYLLGR |
| Ga0209118_10030631 | 3300027674 | Forest Soil | ASKREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIMAVLVIVVILYLLGR |
| Ga0209011_10970401 | 3300027678 | Forest Soil | REKDINTRRNTIKHPILAGDLDPDSPRKVPTNVIIMAVMVIVVILYLLGR |
| Ga0209974_100479992 | 3300027876 | Arabidopsis Thaliana Rhizosphere | RRNTIKHPILAGDLDPDSPRMVPTNVIIMSVMVIIVILYLLGR |
| Ga0307313_102651432 | 3300028715 | Soil | ASKREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIMAVMVIVVILYLLGR |
| Ga0307301_102993591 | 3300028719 | Soil | KREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIMAVMVIVVILYLLGR |
| Ga0307282_101830282 | 3300028784 | Soil | RNTIKHPILAGDLDPDSPRRVPTNIIIGAIAVIVVILYLLGR |
| Ga0307282_102143752 | 3300028784 | Soil | SRRNTIKHPILAGDLDPDSPRRVPTNVIIGAVMVIILILYLLGR |
| Ga0307282_102814601 | 3300028784 | Soil | IKHPILAGDLDPDSPRSVPTNVIIGAIAVIVVILYLLGR |
| Ga0307282_105093291 | 3300028784 | Soil | ASRREKDINSRRNTIKHPILASDMDPDSPRKVPTNVIIMAVMVIIVILYLLGR |
| Ga0307308_105229242 | 3300028884 | Soil | TIKHPILAGDLDPDSPRRVPTKVIIGAVLVIILILYLLGR |
| Ga0307304_103474432 | 3300028885 | Soil | LGVAVIEPAGASKREKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIMAVMVIIVILYLLGR |
| Ga0308189_103701182 | 3300031058 | Soil | PILAGDLDPDSPRRVPTNVIIMAVMVIVVILYLLGR |
| Ga0310810_112177571 | 3300033412 | Soil | ATKREKDISTRRNTIKHPILASDLDPDSPRRVPTNIIIGAIAVIVVILYLLGR |
| Ga0370484_0113543_562_711 | 3300034125 | Untreated Peat Soil | EKDINTRRNTIKHPILAGDLDPDSPRRVPTNVIIGAIAVIIVILYLLGR |
| ⦗Top⦘ |