| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001321 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0090446 | Gp0059788 | Ga0012385 |
| Sample Name | Bioengineered switchgrass rhizosphere microbial community from Knoxville, Tennessee, USA - 15 Joint |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 17265362 |
| Sequencing Scaffolds | 6 |
| Novel Protein Genes | 6 |
| Associated Families | 6 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
| All Organisms → cellular organisms → Bacteria | 2 |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Bioengineered Switchgrass Rhizosphere Microbial Community From Knoxville, Tennessee, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Bioengineered Switchgrass Rhizosphere Microbial Community From Knoxville, Tennessee, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Knoxville, Tennessee, USA | |||||||
| Coordinates | Lat. (o) | 35.98 | Long. (o) | -83.92 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000573 | Metagenome / Metatranscriptome | 1016 | Y |
| F001790 | Metagenome / Metatranscriptome | 633 | Y |
| F013354 | Metagenome | 272 | Y |
| F028907 | Metagenome / Metatranscriptome | 190 | Y |
| F030963 | Metagenome / Metatranscriptome | 183 | Y |
| F049869 | Metagenome | 146 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Microbial15j_103070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| Microbial15j_105141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| Microbial15j_109670 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| Microbial15j_121021 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 537 | Open in IMG/M |
| Microbial15j_134876 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| Microbial15j_140591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 511 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Microbial15j_103070 | Microbial15j_1030701 | F013354 | FRELAKKAEGARLDEIRQTVARLQTDNEKIDLLIQIAGDTQKTNEKLAVQVLDEARQIVNHRATNYQQFEQQLKVAHAFADVDAARAFEVLEPGIGQLNELLQAASTLSGFEINMFRDGEMAIQGGNGLTATVNRYGQELAVLAKNDFERAETLTGRFQFTEPRIMTRLAIVQGLLNAKPVSGGTRIITGGFSETVVTRP* |
| Microbial15j_105141 | Microbial15j_1051411 | F000573 | RLVVSIGIGGAAYAIMLGIMVLSIVYDRELEPVVTFAFDTGRGIIGAIDSLVSGSHWGQVAANHLRERVNMTHVVLSIPAIIIAAIVIGIPFNYLLGGTRTALQRIAIALISVPATVGLAVGLFTFNALLPEAYAVLLRFADLVWHASWNALSSSGDWLPGARKLTNAARQGFSGHHYVIMALCSMAASFLVNALFAFVSRPAPAGIAQPRCD |
| Microbial15j_109670 | Microbial15j_1096702 | F028907 | FNVEIGTALLRFNEEAVLYCRGISDAAAHEYAMDYARMLRSRAKGLEFERTHFSGHLLEPDRNLIEGTLDRMYRKYFGTYRVASKLL* |
| Microbial15j_121021 | Microbial15j_1210211 | F030963 | LGEAGTGFLIIRLVITFLFLVKTRGATLAGVCLHLEAD* |
| Microbial15j_134876 | Microbial15j_1348762 | F001790 | VPPLRFAGCSMPSYDRALWALRTWLDSWPGIGHVAVGMHRQGYDLQL |
| Microbial15j_140591 | Microbial15j_1405911 | F049869 | SFTCQFASTTARDIPVALPVFLNHFDPDTGTLIISSPAVMKRVENVRQRPKVAILFSPVGTEPGEPKHVLLVQGLAEVDDTNLMSGWKRYFAGWARRQPSARESLARMEQVVPGYTQRALIRVRPTRFLGWPDGNFQQSPEVVEVNQ* |
| ⦗Top⦘ |