Metagenome / Metatranscriptome Family F030963

Overview

Basic Information

• Family ID: F030963
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 183
• Average Sequence Length: 44 residues
• Representative Sequence: VLDSDGLGEAGAGFLMTRLVIIFLFLVKTRGATLAEACLRLEAD
• Number of Associated Samples: 112
• Number of Associated Scaffolds: 183

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Eukaryota
• % of genes with valid RBS motifs: 37.16 %
• % of genes near scaffold ends (potentially truncated): 97.81 %
• % of genes from short scaffolds (< 2000 bps): 100.00 %
• Associated GOLD sequencing projects: 111
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Eukaryota (87.978 % of family members)
• NCBI Taxonomy ID: 2759
• Taxonomy: All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (61.749 % of family members)
• Environment Ontology (ENVO): Unclassified (86.885 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (75.956 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 52.78%
  β-sheet: 0.00%
  Coil/Unstructured: 47.22%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 183 Family Scaffolds
PF10536	PMD	0.55

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	87.98 %
Unclassified	root	N/A	12.02 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	87.98 %
Unclassified	root	N/A	12.02 %

Level 3

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	87.98 %
Unclassified	root	N/A	12.02 %

Level 4

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	87.98 %
Unclassified	root	N/A	12.02 %

Level 5

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	87.98 %
Unclassified	root	N/A	12.02 %

Level 6

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	87.98 %
Unclassified	root	N/A	12.02 %

Level 7

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	87.98 %
Unclassified	root	N/A	12.02 %

Level 8

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	87.98 %
Unclassified	root	N/A	12.02 %

Level 9

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	87.98 %
Unclassified	root	N/A	12.02 %

Level 10

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	87.98 %
Unclassified	root	N/A	12.02 %

Level 11

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	87.98 %
Unclassified	root	N/A	12.02 %

Level 12

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	87.98 %
Unclassified	root	N/A	12.02 %

Level 13

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	87.98 %
Unclassified	root	N/A	12.02 %

Level 14

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	87.98 %
Unclassified	root	N/A	12.02 %

Level 15

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	87.98 %
Unclassified	root	N/A	12.02 %

Level 16

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	87.98 %
Unclassified	root	N/A	12.02 %

Level 17

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	87.98 %
Unclassified	root	N/A	12.02 %

Level 18

Name	Rank	Taxonomy	Distribution
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	87.98 %
Unclassified	root	N/A	12.02 %

Level 19

Name	Rank	Taxonomy	Distribution
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	87.98 %
Unclassified	root	N/A	12.02 %

Level 20

Name	Rank	Taxonomy	Distribution
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	87.98 %
Unclassified	root	N/A	12.02 %

Level 21

Name	Rank	Taxonomy	Distribution
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	87.98 %
Unclassified	root	N/A	12.02 %

Level 22

Name	Rank	Taxonomy	Distribution
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	87.98 %
Unclassified	root	N/A	12.02 %

Level 23

Name	Rank	Taxonomy	Distribution
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	87.98 %
Unclassified	root	N/A	12.02 %

Level 24

Name	Rank	Taxonomy	Distribution
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	34.97 %
Unclassified	root	N/A	12.02 %

Level 25

Name	Rank	Taxonomy	Distribution
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	34.97 %
Unclassified	root	N/A	12.02 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001321|Microbial15j_121021	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	537
3300005335|Ga0070666_10634987	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	780
3300005347|Ga0070668_101210653	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	684
3300005347|Ga0070668_101977086	Not Available	537
3300005617|Ga0068859_101595610	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	720
3300005618|Ga0068864_100926052	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	861
3300005719|Ga0068861_100790770	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	889
3300005719|Ga0068861_101737933	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	617
3300005719|Ga0068861_101838135	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	601
3300005843|Ga0068860_100670497	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1045
3300005843|Ga0068860_101336869	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	738
3300009101|Ga0105247_11488139	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	551
3300009553|Ga0105249_10910106	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	947
3300009973|Ga0105136_107859	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	629
3300009975|Ga0105129_105525	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	742
3300009975|Ga0105129_112315	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	600
3300009976|Ga0105128_104640	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	798
3300009976|Ga0105128_105204	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	773
3300009976|Ga0105128_109748	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	649
3300009976|Ga0105128_115689	Not Available	565
3300009976|Ga0105128_119370	Not Available	526
3300009981|Ga0105133_109029	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	728
3300009981|Ga0105133_113020	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	661
3300009989|Ga0105131_111786	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	766
3300009992|Ga0105120_1046521	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	544
3300009993|Ga0105028_126376	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	644
3300009994|Ga0105126_1030352	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	633
3300009994|Ga0105126_1036577	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	593
3300009995|Ga0105139_1056228	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	703
3300009995|Ga0105139_1101599	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	553
3300010371|Ga0134125_12122921	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	611
3300010399|Ga0134127_11782195	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	692
3300010403|Ga0134123_12070737	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	629
3300010403|Ga0134123_12750141	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	560
3300012949|Ga0153798_10206259	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	703
3300015270|Ga0182183_1063222	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	575
3300015278|Ga0182099_1004303	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1060
3300015278|Ga0182099_1063478	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	526
3300015280|Ga0182100_1063220	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	591
3300015280|Ga0182100_1089949	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	522
3300015290|Ga0182105_1016476	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	925
3300015290|Ga0182105_1073482	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	579
3300015301|Ga0182184_1040193	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	688
3300015301|Ga0182184_1067383	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	580
3300015306|Ga0182180_1046423	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	649
3300015309|Ga0182098_1065074	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	639
3300015310|Ga0182162_1109072	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	537
3300015311|Ga0182182_1014948	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1005
3300015311|Ga0182182_1027507	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	836
3300015311|Ga0182182_1110888	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	521
3300015312|Ga0182168_1097779	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	575
3300015312|Ga0182168_1103390	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	562
3300015312|Ga0182168_1130015	Not Available	513
3300015313|Ga0182164_1097746	Not Available	575
3300015315|Ga0182120_1029005	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	886
3300015315|Ga0182120_1060669	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	690
3300015315|Ga0182120_1072540	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	647
3300015315|Ga0182120_1099679	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	574
3300015315|Ga0182120_1107760	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	557
3300015315|Ga0182120_1112486	Not Available	548
3300015317|Ga0182136_1011112	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1179
3300015317|Ga0182136_1050550	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	736
3300015317|Ga0182136_1072816	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	648
3300015317|Ga0182136_1098058	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	580
3300015319|Ga0182130_1093010	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	583
3300015320|Ga0182165_1073170	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	662
3300015325|Ga0182148_1117299	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	548
3300015326|Ga0182166_1053672	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	724
3300015327|Ga0182114_1132330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	548
3300015327|Ga0182114_1146050	Not Available	525
3300015328|Ga0182153_1063294	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	702
3300015328|Ga0182153_1082205	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	640
3300015328|Ga0182153_1096452	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	603
3300015328|Ga0182153_1099995	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	595
3300015329|Ga0182135_1153483	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	504
3300015330|Ga0182152_1117328	Not Available	563
3300015331|Ga0182131_1030712	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	912
3300015331|Ga0182131_1135802	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	532
3300015333|Ga0182147_1024050	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1032
3300015333|Ga0182147_1116837	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	588
3300015334|Ga0182132_1119721	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	583
3300015335|Ga0182116_1096062	Not Available	658
3300015335|Ga0182116_1104125	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	637
3300015335|Ga0182116_1175782	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	506
3300015336|Ga0182150_1067571	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	715
3300015336|Ga0182150_1096689	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	626
3300015336|Ga0182150_1156521	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	516
3300015337|Ga0182151_1024534	Not Available	1003
3300015337|Ga0182151_1029366	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	949
3300015337|Ga0182151_1050976	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	790
3300015337|Ga0182151_1161736	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	508
3300015338|Ga0182137_1117829	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	604
3300015338|Ga0182137_1146213	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	549
3300015339|Ga0182149_1155062	Not Available	528
3300015348|Ga0182115_1244021	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	572
3300015349|Ga0182185_1232959	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	559
3300015349|Ga0182185_1265197	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	524
3300015350|Ga0182163_1147371	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	731
3300015350|Ga0182163_1204708	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	618
3300015350|Ga0182163_1216686	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	600
3300015350|Ga0182163_1246367	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	560
3300015352|Ga0182169_1294756	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	523
3300015352|Ga0182169_1300207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	518
3300015353|Ga0182179_1149235	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	728
3300015353|Ga0182179_1165914	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	694
3300015353|Ga0182179_1226533	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	599
3300015353|Ga0182179_1311306	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	513
3300015354|Ga0182167_1252352	Not Available	636
3300015354|Ga0182167_1329277	Not Available	537
3300015354|Ga0182167_1336899	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	529
3300017408|Ga0182197_1064225	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	698
3300017412|Ga0182199_1167341	Not Available	545
3300017414|Ga0182195_1174760	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	555
3300017414|Ga0182195_1205494	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	519
3300017421|Ga0182213_1134279	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	693
3300017421|Ga0182213_1191736	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	581
3300017422|Ga0182201_1094520	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	584
3300017422|Ga0182201_1137182	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	512
3300017432|Ga0182196_1073400	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	654
3300017432|Ga0182196_1101608	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	585
3300017435|Ga0182194_1050047	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	762
3300017439|Ga0182200_1106695	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	586
3300017440|Ga0182214_1115233	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	581
3300017445|Ga0182198_1104794	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	650
3300017445|Ga0182198_1112910	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	632
3300017692|Ga0182210_1118761	Not Available	577
3300017693|Ga0182216_1089064	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	725
3300017693|Ga0182216_1091711	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	717
3300017694|Ga0182211_1173006	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	516
3300020033|Ga0182146_104108	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	586
3300025910|Ga0207684_11183044	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	634
3300025910|Ga0207684_11339141	Not Available	588
3300025923|Ga0207681_11589299	Not Available	548
3300025961|Ga0207712_11975628	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	522
3300026035|Ga0207703_11475078	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	654
3300026088|Ga0207641_11037243	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	817
3300026088|Ga0207641_12256761	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	544
3300026088|Ga0207641_12606306	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	503
3300028051|Ga0268344_1014997	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	599
3300028052|Ga0268300_1010297	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	538
3300028057|Ga0268352_1041842	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	513
3300028058|Ga0268332_1047206	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	611
3300028058|Ga0268332_1059635	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	560
3300028058|Ga0268332_1072584	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	520
3300028061|Ga0268314_1021657	Not Available	695
3300028061|Ga0268314_1027147	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	645
3300028061|Ga0268314_1043505	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	546
3300028063|Ga0268350_1060066	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	548
3300028063|Ga0268350_1067131	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	515
3300028139|Ga0268355_1007335	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	675
3300028139|Ga0268355_1017589	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	516
3300028140|Ga0268334_1009658	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	631
3300028144|Ga0268345_1023870	Not Available	539
3300028151|Ga0268308_1014313	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	663
3300028153|Ga0268320_1026616	Not Available	524
3300028154|Ga0268341_1018569	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	597
3300028256|Ga0268304_1005592	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	692
3300028262|Ga0268310_1027764	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	623
3300028464|Ga0268302_108276	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	518
3300028465|Ga0268301_104361	Not Available	546
3300028466|Ga0268321_108198	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	557
3300028470|Ga0268307_1008445	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	698
3300028471|Ga0268323_1005383	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	753
3300028477|Ga0268309_1018677	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	528
3300028477|Ga0268309_1022291	Not Available	501
3300032466|Ga0214503_1195633	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	630
3300032467|Ga0214488_1077613	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	732
3300032467|Ga0214488_1115394	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	574
3300032469|Ga0214491_1029286	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1274
3300032502|Ga0214490_1106173	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	641
3300032502|Ga0214490_1155183	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	516
3300032514|Ga0214502_1188153	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	792
3300032548|Ga0214483_1072467	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	568
3300032551|Ga0321339_1115464	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	605
3300032697|Ga0214499_1227308	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	576
3300032757|Ga0314753_1031698	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	959
3300032758|Ga0314746_1112367	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	621
3300032761|Ga0314733_1094897	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	562
3300032913|Ga0314739_1043210	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	849
3300032914|Ga0314750_1151411	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	539
3300032915|Ga0314749_1043084	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	967
3300032916|Ga0314734_1060148	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	766
3300032934|Ga0314741_1136735	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	552

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	96.17%
Environmental	Environmental	3.28%
Engineered	Engineered	0.55%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	96.17%
Terrestrial	Environmental → Terrestrial	3.28%
Bioreactor	Engineered → Bioreactor	0.55%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	76.50%
Unclassified	Host-Associated → Plants → Unclassified	9.29%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.56%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.83%
Soil	Environmental → Terrestrial → Soil	3.28%
Unclassified	Engineered → Bioreactor → Unclassified	0.55%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	76.50%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	9.29%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.56%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.19%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.19%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.64%
Loam	Environmental → Terrestrial → Soil → Loam	1.09%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.55%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	76.50%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	9.29%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.56%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	2.19%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.19%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.64%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.09%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.55%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	61.75%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	14.75%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	9.29%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	6.56%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.64%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.09%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.55%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001321	Bioengineered switchgrass rhizosphere microbial community from Knoxville, Tennessee, USA - 15 Joint	Host-Associated
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009973	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG	Host-Associated
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated
3300009993	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG	Host-Associated
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300012949	Switchgrass enrichment cultures co-assembly	Engineered
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300020033	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG	Host-Associated
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated
3300028052	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1	Host-Associated
3300028057	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1	Host-Associated
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated
3300028063	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1	Host-Associated
3300028139	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1	Host-Associated
3300028140	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1	Host-Associated
3300028144	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1	Host-Associated
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated
3300028256	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1	Host-Associated
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated
3300028464	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1	Host-Associated
3300028465	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_15MAY2017_LD1	Host-Associated
3300028466	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1	Host-Associated
3300028470	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1	Host-Associated
3300028471	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1	Host-Associated
3300028477	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1	Host-Associated
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032469	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032514	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032548	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032551	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032757	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032758	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032761	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032913	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032914	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032915	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032916	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032934	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Microbial15j_1210211	3300001321	Switchgrass Rhizosphere	LGEAGTGFLIIRLVITFLFLVKTRGATLAGVCLHLEAD*
Ga0070666_106349873	3300005335	Switchgrass Rhizosphere	MLDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLAEVCLRLEAD
Ga0070668_1012106532	3300005347	Switchgrass Rhizosphere	SDGLGDAGAGFLITRLVIIFLFLVKTRGATTAEACLRLEAD*
Ga0070668_1019770862	3300005347	Switchgrass Rhizosphere	LVLDSDGLGEAYADFLMTRLVIIFLFLVGTRGAALVEVCLRLEADWSKSG*
Ga0068859_1015956101	3300005617	Switchgrass Rhizosphere	EAGAGFLMTRLVIIFLFLVKTRGATTAEACLRLEAD*
Ga0068864_1009260523	3300005618	Switchgrass Rhizosphere	MLDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLAEVCLRLEAD*
Ga0068861_1007907702	3300005719	Switchgrass Rhizosphere	TWLVLDSDGLGEACADFLMTRLVIIFLFLVGTRGAALAEVCLRLEADWSKSG*
Ga0068861_1017379331	3300005719	Switchgrass Rhizosphere	VLDSDGLGEACADFLMTRLVIIFLFLVGTRGAALAEVCLRLEADW
Ga0068861_1018381351	3300005719	Switchgrass Rhizosphere	WLVLDSDGLGEACADFLMTRLVIIFLFLVGTRGATLAEVCLCLEADWSKSG*
Ga0068860_1006704971	3300005843	Switchgrass Rhizosphere	DSDGLGEACADFLMTRLVIIFLFLVGTRGAALAEVCLRLEADWSKSG*
Ga0068860_1013368691	3300005843	Switchgrass Rhizosphere	MLDSDGLGEDGIGFLMTRLVIIFLFLVKTRGATLAEVCL
Ga0105247_114881391	3300009101	Switchgrass Rhizosphere	LVLDSDGLREAGAGFLMTHLVIIFLFLVKTRGATLAE
Ga0105249_109101061	3300009553	Switchgrass Rhizosphere	VLDSDGLGEAGADFLMIHIVIIFLFLVMTRGAKITEACLRLEAD*
Ga0105136_1078591	3300009973	Switchgrass Associated	SDGLGEVGTGFLITRLLIIFLFLVKTRGATTVEVCFRLKAD*
Ga0105129_1055253	3300009975	Switchgrass Associated	MLNSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLAEVCLRLEAD
Ga0105129_1123153	3300009975	Switchgrass Associated	VLDSDGLGEAGDDFLITHLVIIFLFLVKTRGAMLAEACLRLEA
Ga0105128_1046401	3300009976	Switchgrass Associated	VLDSDGLGEAGAGFLMTRLVIIFLFLVKTRGATLVEVCLHLEADCSE
Ga0105128_1052041	3300009976	Switchgrass Associated	VLESDGLGEGCAVFLMTRLVKIFLFLVGTRGAALPEICLRLEADWGEFG
Ga0105128_1097481	3300009976	Switchgrass Associated	LVRWITWLVLDSDGFGEACAGFLMNRLVIIFLFLVGTRGAALAEV
Ga0105128_1156891	3300009976	Switchgrass Associated	EEAGAGFLITRLVIVFLFLVKTRGATLAEVCLRLEAD*
Ga0105128_1193701	3300009976	Switchgrass Associated	LELDSDGLGEGCAVFLMIRLAMIFLFLVGIRGGATFAEICLRLEADCSM
Ga0105133_1090292	3300009981	Switchgrass Associated	VLDSDGLGEAGASFLITCLVIIFLFLVKTQGETITEACLHLEAD*
Ga0105133_1130201	3300009981	Switchgrass Associated	ERWNTWLVLESDGLGEGSAVFLMTRLVKIFLFLVGTRGAALPEVCLRL*
Ga0105131_1117861	3300009989	Switchgrass Associated	MLDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLA
Ga0105120_10465211	3300009992	Switchgrass Associated	DGHGEAGAGFLIMRLVIIFLFLVKTRGATLAEVCLRLKAG*
Ga0105028_1263762	3300009993	Switchgrass Associated	AGAGFLITRLVIIFFFLVKTRGAMLAEVCLRLEADCSKSG*
Ga0105126_10303521	3300009994	Switchgrass Associated	VLESDGLGEGCAVFLMTRLVMIFLFLVGTREVALPENCLRLEADCGE
Ga0105126_10365771	3300009994	Switchgrass Associated	DSDGLGEACADFLMTRLVIIFLFLVGIREAALAEVCLCLEADWSKSG*
Ga0105139_10562282	3300009995	Switchgrass Associated	WLVLDSDGLGEACADFLMTRLVIIFLFLVGTRGAALAEVCLHLEADWSKSG*
Ga0105139_11015991	3300009995	Switchgrass Associated	GLGGDGTGFLMTRLVIIFLFLVKTRGAMLAEVCLRLGADWSKSG*
Ga0134125_121229211	3300010371	Terrestrial Soil	VLDSDGLGEAGAGFLMTRLVIIFLFLVKTRGATLAEACLRLEAD
Ga0134127_117821951	3300010399	Terrestrial Soil	VLKSDGLGDAGAGFLITRLVIIFLFLVKTRGATTAEACLRLEA
Ga0134123_120707371	3300010403	Terrestrial Soil	WLVLNSDGLGDAGAGFLITRLVIIFLFLVKTRGATTAEACLRLEAD*
Ga0134123_127501411	3300010403	Terrestrial Soil	VLDSDGLGGDGTGFLMTRLVIIFLFLVKTRGAMFAEV
Ga0153798_102062593	3300012949	Switchgrass Degrading	LVLDSDGLGEAGAGFLITRLVIIFLFLVKTRGATLA
Ga0182183_10632221	3300015270	Switchgrass Phyllosphere	VLASDGLGEAGADFLMTRLVIIFLFLVKTRGATIAEACLRLEAD
Ga0182099_10043033	3300015278	Switchgrass Phyllosphere	VLDSDGLGEAGAGFLITRLVIIFLFLVKTRGAMLAEVCLRLEA
Ga0182099_10634782	3300015278	Switchgrass Phyllosphere	VTWLVLDSDGLGGDGTGFLMTRLVIIFLFLVKTRGAMLAEVCLHLEADWSKSG*
Ga0182100_10632202	3300015280	Switchgrass Phyllosphere	LDSDGLGEAGAGFLITRLVIIFLFLVKTRGATLAEVCLPLEAD*
Ga0182100_10899491	3300015280	Switchgrass Phyllosphere	TWLAFDSDGLGEAGTGFLMTRLVIIFLFLVKTRGATIAEACLRLEAD*
Ga0182105_10164761	3300015290	Switchgrass Phyllosphere	VLESDGLGEGCAVFLMTHLVQIFLFLVGTRGAAPPENCLRLEAD
Ga0182105_10734822	3300015290	Switchgrass Phyllosphere	VLNSDGLGDAGAGFLITRLVIIFLFLVKTRGATTAEACLRLEAD*
Ga0182184_10401933	3300015301	Switchgrass Phyllosphere	MLDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLAEVCLRLE
Ga0182184_10673831	3300015301	Switchgrass Phyllosphere	LVLDSDGLGEAGADFLMTRLVIIFLFLVKTRGATIAEACLRLE
Ga0182180_10464232	3300015306	Switchgrass Phyllosphere	LVLDSDGFGEAGAGFLITRLVIIFLFLVKTRGATLAEVCLRLEAD*
Ga0182098_10650742	3300015309	Switchgrass Phyllosphere	DGLGEACADFLMIRLVIIFLFLVGTRGAALAEVCLRLKADWSKSG*
Ga0182162_11090722	3300015310	Switchgrass Phyllosphere	ESDGLGEGCAVFLMTRLVKIFLFLVGTRGAAPSENCLRLEADCSTSG*
Ga0182182_10149481	3300015311	Switchgrass Phyllosphere	TWLVLDSDGLGEACADFLMTRLVIIFLFLVGTRGVALAIVCLRLEAD*
Ga0182182_10275072	3300015311	Switchgrass Phyllosphere	VLDSDGLGEACADFLMTRLVIIFFFLVGTRGAALAEVCLRLEA
Ga0182182_11108882	3300015311	Switchgrass Phyllosphere	GAGFLITRLVIVFLFLVKTRGATTAEACLRLEAD*
Ga0182168_10977791	3300015312	Switchgrass Phyllosphere	LVLDSDGFGEAGTGFLITRLVIIFLFLVKTRGATLAEVCLRL
Ga0182168_11033901	3300015312	Switchgrass Phyllosphere	DSDGLGGDGTGFLITRLVIIFLFLVKTRGAATAEVCLRLEAD*
Ga0182168_11300151	3300015312	Switchgrass Phyllosphere	LVRWITWLVLDSDGLGEACADFLMTRLVIIFLFLVGTRGAALAEV
Ga0182164_10977461	3300015313	Switchgrass Phyllosphere	VLDSDGLGEACADFLMTRLVIIFLFLVGTPGAALAEVCLHLEAN
Ga0182120_10290051	3300015315	Switchgrass Phyllosphere	LELISDGVEEDGTIFSVIFLVIIFLFLVRTQGATVAEVCLRLE
Ga0182120_10606692	3300015315	Switchgrass Phyllosphere	TWLVLDSDGLGEAGAGFLMTRLVIIFLFLVKTWGATLAEACLRLEAD*
Ga0182120_10725401	3300015315	Switchgrass Phyllosphere	LDSDGLGEAGAGFLITRLVIIFLFLVKTRGATLAEVCLRLEAD*
Ga0182120_10996791	3300015315	Switchgrass Phyllosphere	TWLELVSDGLGEDWTIFLMILFVIIFLFLVGTRGATIAEACLRLEAD*
Ga0182120_11077601	3300015315	Switchgrass Phyllosphere	LELVSDGLGEDWTIFLMILFVIIFLFLVGTRGATIAEAC
Ga0182120_11124861	3300015315	Switchgrass Phyllosphere	MLDSDGLGEDGTDFLMTRLVIIFLFLVKTRGATLAEVCLRLEAD
Ga0182136_10111121	3300015317	Switchgrass Phyllosphere	VLDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLAEVCLRLEA
Ga0182136_10505503	3300015317	Switchgrass Phyllosphere	VLESDGLVEDCAVFLMTRLVKIFLFLVGTRGAALPEVCLRL
Ga0182136_10728162	3300015317	Switchgrass Phyllosphere	TWLVLDSDGLGEAGAVFLMTRLVIIFLFLVKTRGATIAEVCLRLEVDWSKSG*
Ga0182136_10980581	3300015317	Switchgrass Phyllosphere	VLESDGLGEGCAVFLMTRLVKIFLFLVGTRGAVLPEICHRLGADWGES
Ga0182130_10930101	3300015319	Switchgrass Phyllosphere	VLDSDGLGGDGAGFLMTRLVIIFLFLVKTRGAMLAEVCLRLEADWS
Ga0182165_10731702	3300015320	Switchgrass Phyllosphere	VTWLVLDSDGLGEAGAGFLITRLVIIFLFLVKTRGAMLAEVCLRLEAN*
Ga0182148_11172991	3300015325	Switchgrass Phyllosphere	ITWLELVSDGLGEDWIIFLMILFVIIFLFLVGTRGATIAETCLRLEAD*
Ga0182166_10536722	3300015326	Switchgrass Phyllosphere	ITWLVLDSDGLVEACADFLMTRLAIIFLFLVGTRGATLVEVCLRLEADWSKSG*
Ga0182114_11323301	3300015327	Switchgrass Phyllosphere	AGAGFLMTRLVIIFLFLVKTRGATLVEVCLRLEAG*
Ga0182114_11460501	3300015327	Switchgrass Phyllosphere	LELVSDGLGEDWTIFLMILFVIIFLFLVGTRGATIAEACL
Ga0182153_10632941	3300015328	Switchgrass Phyllosphere	VLASDGLREAGTGFLMTRLVIIFHFLVKTRGATLAEASLRL
Ga0182153_10822052	3300015328	Switchgrass Phyllosphere	WLVLESDGLGEGCAVFLMTRLVKIFLFLVGTRGAAPPEICLRLEADWGESG*
Ga0182153_10964521	3300015328	Switchgrass Phyllosphere	TWLELVSDGLGEDWTIFLMILLVIIFRFLVGTRGATFAEVCLRLEAD*
Ga0182153_10999951	3300015328	Switchgrass Phyllosphere	FGVDGFGGAGAGFLMARLVIIFLFLVKTRGGGATIAEACLRLEADSSKSG*
Ga0182135_11534831	3300015329	Switchgrass Phyllosphere	LVLDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLAE
Ga0182152_11173281	3300015330	Switchgrass Phyllosphere	LVLDSDGLEEAGTGFLITRLVIIFLFLVKTRGATLAEVCLRLEA
Ga0182131_10307121	3300015331	Switchgrass Phyllosphere	VLDSDGLGEAGAGFLMTRLVIIFLFLVKTRGATLAEASLRLEAD
Ga0182131_11358021	3300015331	Switchgrass Phyllosphere	VLDSDGLGEAGAGFLTTRLVIIFLFLVKTRGATTAEA
Ga0182147_10240501	3300015333	Switchgrass Phyllosphere	VLDSDGLGEACADFLMTRLVIIFLFLVGTRGAAFAEVCLRLEADWSKSG
Ga0182147_11168372	3300015333	Switchgrass Phyllosphere	WLVLDSDGLGEAGADFLITRLVIIFLFLVKTRGATLAEACLRLEADSSKFG*
Ga0182132_11197211	3300015334	Switchgrass Phyllosphere	EVGTGFLITRLVIIFLFLVKTRGATTAEVCLRLKAD*
Ga0182116_10960623	3300015335	Switchgrass Phyllosphere	VLESDGLGEGCAVFLMTRLVKIFLFLVGTRGAALPEVCLRLEADWGESG
Ga0182116_11041251	3300015335	Switchgrass Phyllosphere	LVLDSDRFGEGCTVFLITRLAMIFLFLVGTRGAALPEVCLRLEADWGEYG*
Ga0182116_11757821	3300015335	Switchgrass Phyllosphere	VLESDGLGEGWAVFLMTRLVKIFLLLVGTRGVVLPE
Ga0182150_10675711	3300015336	Switchgrass Phyllosphere	LGEACADFLMTRLVIIFLFLVGTRGATLAEVCLHLEADWSKSG*
Ga0182150_10966892	3300015336	Switchgrass Phyllosphere	LVLNSDGLGDAGAGFLITRLVIIFLFLVKTRGATTAEACLRLEAD*
Ga0182150_11565212	3300015336	Switchgrass Phyllosphere	GTGFLITRLVIIFLFLVKTRGATTAEVCLRLKAD*
Ga0182151_10245342	3300015337	Switchgrass Phyllosphere	VLDSDGFGEAGAGFLMTRLMIIFLFLVKTQGATTEELCDKHGYDAR*
Ga0182151_10293662	3300015337	Switchgrass Phyllosphere	GLGEACADFLMTRLVIIFLFLVGTRGVALAEVCLRLEADWSKSG*
Ga0182151_10509761	3300015337	Switchgrass Phyllosphere	VRWITWLVLDSDGLGEACADFLMTRLVIIFLFLVGTRGGAALAEV
Ga0182151_11617361	3300015337	Switchgrass Phyllosphere	WLVLDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLAGVCLRLEAD*
Ga0182137_11178291	3300015338	Switchgrass Phyllosphere	ITWLVLDSDGLGEAGVDFLMTRLVIIFLFLVKTRGATLAEVCLCLEAD*
Ga0182137_11462131	3300015338	Switchgrass Phyllosphere	VTWLVLDSDGLGGDGTGFLITRLVIIFLFLVKTRGAATAEVCLRLEAD*
Ga0182149_11550621	3300015339	Switchgrass Phyllosphere	VLDSDGLGEACADFLMTRLVIIFLFLVVTRGAALAEVCLRLEADWS
Ga0182115_12440211	3300015348	Switchgrass Phyllosphere	WLVLDSDGLGEAGAGFLITRLVIIFLFLVKTRGATLAGVCLRLEAD*
Ga0182185_12329591	3300015349	Switchgrass Phyllosphere	LEEAGAGFLITRLVIVFLFLVKTRGATLAEVCLRLEAD*
Ga0182185_12651971	3300015349	Switchgrass Phyllosphere	LELESDGLGEGCVVFLMTRLVKIFLFLVGTRGAAPPE
Ga0182163_11473712	3300015350	Switchgrass Phyllosphere	VRWITWLVLDSDGLGEACADFLMTRLVIIFLFLVGTRGAALAEVCLRLEADWSKSG*
Ga0182163_12047083	3300015350	Switchgrass Phyllosphere	VLDSDGLGGDGTGFLMTRLVIIFLFLVKTRGAMLAEVCLRL
Ga0182163_12166862	3300015350	Switchgrass Phyllosphere	DGFGEVGAGFLTTPLVIIFLFLVKTRGATLAEVCLRLEAD*
Ga0182163_12463671	3300015350	Switchgrass Phyllosphere	MLDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLAE
Ga0182169_12947561	3300015352	Switchgrass Phyllosphere	ITWLELVSDGLGEDWTIFLMILFVIIFLFLVGTRGATIAETCLRLEAD*
Ga0182169_13002072	3300015352	Switchgrass Phyllosphere	LVLDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLAEVCLRLEAD*
Ga0182179_11492351	3300015353	Switchgrass Phyllosphere	VLDSDGLGEVCADFLMTRLVIIFLFLVGTRGATLAEVCLRLEADWSKS
Ga0182179_11659141	3300015353	Switchgrass Phyllosphere	GEACADFLMTRLVIIFLFLVGTRGATLVEVCLHLEADWSKSG*
Ga0182179_12265332	3300015353	Switchgrass Phyllosphere	GFGEAGAGFLTTRLVIIFLFLVKTRGATLAEVCLRLEAD*
Ga0182179_13113062	3300015353	Switchgrass Phyllosphere	LVLDSDGLEEAGAGFLITRLVIIFLFLVKTRGATLA
Ga0182167_12523521	3300015354	Switchgrass Phyllosphere	VLDSDGLGEACADFLMTRLVIIFLFLVGTRGAALAEDCLRLEADWIKSG*
Ga0182167_13292771	3300015354	Switchgrass Phyllosphere	LVLDSDGLGGDITGFLITRLVIIFLFLVKTRGATTAEACLRLEADWS
Ga0182167_13368991	3300015354	Switchgrass Phyllosphere	SDGLGEAGAGFLMTRLVIIFLFLVKTRGATIAEACLRLEAD*
Ga0182197_10642252	3300017408	Switchgrass Phyllosphere	LDSNGLGEGCAVFLMTRLAMIFLFLVGPRGATLTEVCLRLEADWGKSS
Ga0182199_11673411	3300017412	Switchgrass Phyllosphere	VLDSDGLGEVCADFLMTRLVIIFLFLVGTRGAALVEVCLRLEADWSKSG
Ga0182195_11747601	3300017414	Switchgrass Phyllosphere	EAGTGFLMTRLVIFLFLVKTRGATIAEACLRLEADSSKSG
Ga0182195_12054942	3300017414	Switchgrass Phyllosphere	DGLGEDGTGFLMTRLVIIFLFLVKTRGATLAEVCLRLEADWSKSG
Ga0182213_11342791	3300017421	Switchgrass Phyllosphere	WFVLDSDGLGEACADFLMIRLVIILLFLVGTREATLA
Ga0182213_11917362	3300017421	Switchgrass Phyllosphere	VLDSNGLGGDGTGFLMTCLVIIFLFLVKTRGVMLAEVCLRLE
Ga0182201_10945201	3300017422	Switchgrass Phyllosphere	DADGLGEGCTVFLMIRLAMTFLFLVRTRGATIAEVCLRLEADCSKSG
Ga0182201_11371821	3300017422	Switchgrass Phyllosphere	VTWLVLDSDGLGEACADFLMTRLVIIFLFLVSTRGAALVEVCLRLEADWSKSG
Ga0182196_10734003	3300017432	Switchgrass Phyllosphere	VFDSDGLREAGAGFLMTRLVIIFLFLVKTRGTTVTEACLHLEA
Ga0182196_11016082	3300017432	Switchgrass Phyllosphere	DGLGEACADFLMTRLVIIFLFLVGTRGATLAEVCLRLEADWSKSG
Ga0182194_10500472	3300017435	Switchgrass Phyllosphere	TWLVLDSDGLGEACADFLMTRLVIIFLFLVGTRGAALAEVCLRLEADWSKSG
Ga0182200_11066951	3300017439	Switchgrass Phyllosphere	LELDSDGLGEGCAVFLMIRLTMIFLFLVGTRGATFVEICLRLEADCSTSG
Ga0182214_11152331	3300017440	Switchgrass Phyllosphere	VLDSDGLGGDITGFLITRLVIIFLFLVKTRGATLAEVCL
Ga0182198_11047942	3300017445	Switchgrass Phyllosphere	GLGEACADFLMTRLVIIFLFLVGTRGAALAEVCLHLEADWSKSS
Ga0182198_11129101	3300017445	Switchgrass Phyllosphere	WLVLDSDGLGEAGADFLITRLVIIFLFLVKTRGATLAEACLRLEADSSKSC
Ga0182210_11187611	3300017692	Switchgrass Phyllosphere	VLDSDGLGGDGTGFLMTRLVIIFLFLVKTRGAMLAEVCLRLEADWSKS
Ga0182216_10890641	3300017693	Switchgrass Phyllosphere	VLDSDGFGEDGTGFLTTRLVIIFLFLVKTRGATLAEVCLR
Ga0182216_10917112	3300017693	Switchgrass Phyllosphere	VSDGVEEDGTTFLMILFVIIFLFLVGIRRATFVEVYLRLEADWSRSG
Ga0182211_11730061	3300017694	Switchgrass Phyllosphere	WLVLDSDGLGGDGTGFLMTRLVIIYLFLVKTRGAMFAEVCLRLEAD
Ga0182146_1041081	3300020033	Switchgrass Phyllosphere	VLDSDGLGEAGASFLITRFVIIFLFLVKTRGAMLAEVCLRLEADWGK
Ga0207684_111830441	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	TWLVFDSDGLGEAGDGFLMTRLVIVFLFLVKTRGATITEACLRLEAD
Ga0207684_113391412	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	VLDSDGLGEACADFLMTRLVIIFLFLVGTRGAALAEVCLRLEAD
Ga0207681_115892992	3300025923	Switchgrass Rhizosphere	VLDSDGLGEACADFLMTRLVIIFLFLVGTRGATLAEVC
Ga0207712_119756281	3300025961	Switchgrass Rhizosphere	VLESDGLGEGCAVFLMTHLVQIFLFLVGTRGAAPPENCLRLEADCSTSG
Ga0207703_114750782	3300026035	Switchgrass Rhizosphere	LVLDSDGLGEAGADFLITRLVIIFLFLVKTRGATLAEVCLRLEAD
Ga0207641_110372432	3300026088	Switchgrass Rhizosphere	VLKSDGLGDAGAGFLITRLVIIFLFLVKTRGATTAEACLRLEAD
Ga0207641_122567611	3300026088	Switchgrass Rhizosphere	GFLITRLVIIFLFLVKTRGATLAEVCLRLEADSSKSG
Ga0207641_126063061	3300026088	Switchgrass Rhizosphere	MLDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLAEV
Ga0268344_10149971	3300028051	Phyllosphere	LGEAGAGFLMTRLVIIFLFLVKTRGATLAGVCLRLEAD
Ga0268300_10102971	3300028052	Phyllosphere	GFGEAGAGFLITRLVIIFLFLVKTRGATLAEVCLRLEAD
Ga0268352_10418421	3300028057	Phyllosphere	EVLERWITWLVLDSDGLGEACADFLMTRLVIIFLFLVGTRGATLAEVCLRLEADWSKSG
Ga0268332_10472061	3300028058	Phyllosphere	LAFDSDGLGEAGTGFLMTRLVIIFLFLVKTRGATIAEAC
Ga0268332_10596351	3300028058	Phyllosphere	GTGFLMTRLVIIFLFLVKTRGATIAEACLRLEADSSKSG
Ga0268332_10725841	3300028058	Phyllosphere	SDGLGEVGTGFLITRLVIIFLFLVKTRGATTAKACLRLKAD
Ga0268314_10216571	3300028061	Phyllosphere	VLDSDGLGEACADFLMTRLVIIFLFLVGTRGATLAEV
Ga0268314_10271472	3300028061	Phyllosphere	EACADFLMTRLVILFLFLVGTWGAALAEVCLRLEADWSKSG
Ga0268314_10435052	3300028061	Phyllosphere	VLDSDGLGEACADFLMTRLVIIFLFLVRTRGATLTEVCLRLEADWSKSG
Ga0268350_10600661	3300028063	Phyllosphere	VLDSDGLGGDGTGFLMTRLVIIFLFLVKTRGAMFAEVCLR
Ga0268350_10671311	3300028063	Phyllosphere	EAGASFLITRFVIIFLFLVKTRGAMLAEVCLRLEADWSKSG
Ga0268355_10073352	3300028139	Phyllosphere	VAWLVLDSDGLGEACADFLMTRLVIIFLFLVGTRGATLAEVCLRLEADWSKSG
Ga0268355_10175892	3300028139	Phyllosphere	VLDSDGLGEAGAGFLITRLVIIFLFLVKTRGAMLAEVC
Ga0268334_10096582	3300028140	Phyllosphere	LNSDGLGDAGAGFLITRLVIIFLFLVKTRGATTAEACLRLEAD
Ga0268345_10238702	3300028144	Phyllosphere	LAFDSDGLGEAGTGFLMTRLVIIFLFLVKTRGATIAEACLRLEADSSKS
Ga0268308_10143133	3300028151	Phyllosphere	VLDSDGLEEAGAGFLMIRLVIIFLFLVKTREATVIEACLRL
Ga0268320_10266161	3300028153	Phyllosphere	VFDSDGLGEACADFLMTRLMIIFLFLVGTRGAALA
Ga0268341_10185691	3300028154	Phyllosphere	EDGTGFLMTRLVIIFLFLVKTRGATLAEVCLRLEAD
Ga0268304_10055923	3300028256	Phyllosphere	VLDSDGLGGDGTGFLMTRLVIIFLFLVKTRGAMLAEVCLRLGADWSKS
Ga0268310_10277641	3300028262	Phyllosphere	LGDAGAGFLITRLVIIFLFLVKTRGATTAEACLRLEADWSKSG
Ga0268302_1082763	3300028464	Phyllosphere	VTCLVLDSDGLGGDGTGFLMTRLVIIFLFLVKTRGAMLAEVCLRLEADWSKSG
Ga0268301_1043612	3300028465	Phyllosphere	MLDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLAEVCLRLEADXS
Ga0268321_1081981	3300028466	Phyllosphere	LVFDSDGLGEAGAGFLMIRLVIIFLFLVKTRGATVTEACL
Ga0268307_10084451	3300028470	Phyllosphere	LESDGLGEGCAVFLMTRLVKIFLFLVGTRGAAPPENCLRLEADCSTSG
Ga0268323_10053832	3300028471	Phyllosphere	LDSDGLGEACADFLMNRLVIIFLFLVGTWGAALAEVCLRLEADWSKSG
Ga0268309_10186772	3300028477	Phyllosphere	DGLGEASAGFLITRLVIIFLFLVKTRGATLAEVCLRLEAD
Ga0268309_10222912	3300028477	Phyllosphere	MLDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLTEVCLRL
Ga0214503_11956333	3300032466	Switchgrass Phyllosphere	VLDSDGFGEAGAGFLITRLVIIFLFLVKARGAMLAEVCHRLEAD
Ga0214488_10776132	3300032467	Switchgrass Phyllosphere	LDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLTEVCLRLEAD
Ga0214488_11153941	3300032467	Switchgrass Phyllosphere	MLDSDGLGEDGTGFLMTRLVIIFLFLVKTRGATLAEVCLRLEADXSKSGWTVII
Ga0214491_10292862	3300032469	Switchgrass Phyllosphere	GMSSAASWLVLDSDGLGEAGTSFLMTRLVIIFLFLVKTRGATLAEASLRLEADWSKSG
Ga0214490_11061732	3300032502	Switchgrass Phyllosphere	REACADFLMTRLVIIFLFLVGIRGAALAEGCLRLEAD
Ga0214490_11551832	3300032502	Switchgrass Phyllosphere	LDSDGLGEAGAGFLITRLVIIFLFLVKTRGATLAEVCLRLEAD
Ga0214502_11881531	3300032514	Switchgrass Phyllosphere	SDRLGEAGASFLITRFVIIFLFLVKTRGAMFAEVCLRLEADWSKSG
Ga0214483_10724671	3300032548	Switchgrass Phyllosphere	LLFDSDGLGEAGAGFLMTRLVIIFLFLVKTRGATLAEVCLHLEAD
Ga0321339_11154642	3300032551	Switchgrass Phyllosphere	EVGTGFLITRLVIIFLFLVKTRGATTAEACLRLEAD
Ga0214499_12273082	3300032697	Switchgrass Phyllosphere	VTWLVLDSDGLGGDGTGFLMTRLVIIFLFLVKTRGAMLAEVCLRLGADWSKSG
Ga0314753_10316982	3300032757	Switchgrass Phyllosphere	VLDSDGLGEAGAVFLITRLVIIFLFLVKTQGGATLAEVCLHLEAD
Ga0314746_11123672	3300032758	Switchgrass Phyllosphere	DGTGFLITRLVIIFLFLVKTRGATTAEACLRLEAD
Ga0314733_10948971	3300032761	Switchgrass Phyllosphere	MSSAASWLVLDSDGLGDAVAGFLTTRVVIIFIFLVKTQGATLAEVCLRLEAD
Ga0314739_10432101	3300032913	Switchgrass Phyllosphere	EAGAGFLITRLVIIFLFLVKTRGETTAEACLRLKAD
Ga0314750_11514112	3300032914	Switchgrass Phyllosphere	LVLDSDRLGEAGASFLITRFVIIFLFLVKTRGAMFAEVCLRLEAD
Ga0314749_10430842	3300032915	Switchgrass Phyllosphere	VLNSDGLGDAGADFLITRLVIIFLFLVKTRGATTAEACLRLEAD
Ga0314734_10601481	3300032916	Switchgrass Phyllosphere	VLDSDGLGGDGTGFLMTRLVIIFLFLVKTRGAMFAEVCLRLEA
Ga0314741_11367351	3300032934	Switchgrass Phyllosphere	LGNAGAGFLITRLVIIFLFLVKTRGATIAEACLRLEADWSKSG