| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001286 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0069861 | Gp0054471 | Ga0000298 |
| Sample Name | Groundwater microbial communities from S. Glens Falls, New York, USA - Naphthalene biodegradation metagenome 12C5dose |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 15388853 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater biome → anthropogenic contamination feature → contaminated water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | S. Glens Falls, New York, USA | |||||||
| Coordinates | Lat. (o) | 43.292222 | Long. (o) | -73.604444 | Alt. (m) | N/A | Depth (m) | 98 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI12103J14257_105705 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI12103J14257_105705 | JGI12103J14257_1057051 | F077438 | EEFSVTSLCCVYSTHRVERSFTQSRLETLFLWNLQVEISAALRSMVE* |
| ⦗Top⦘ |