3300001221: Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_2

Overview

Basic Information

• IMG/M Taxon OID: 3300001221
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0087863 | Gp0055918 | Ga0012428
• Sample Name: Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_2
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Tennessee
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 1956787
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere

Location Information

• Location: East Tennessee Research and Education Center, Knoxville, Tennessee, USA
• Coordinates
  • Lat. (^o): 35.9606
  • Long. (^o): -83.9208
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000788	Metagenome / Metatranscriptome	891	Y
F029958	Metagenome / Metatranscriptome	186	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
SwM_12973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	515
SwM_14816	Not Available	613

Sequences

Scaffold ID	Protein ID	Family	Sequence
SwM_12973	SwM_129731	F000788	MKPRTVYEKAVQDFTEIAQQLARLNQHFRQASFSEFEMLMGLDDEVLKRYGLPKPTVKRALIEVYQTVVLDQAR*
SwM_14816	SwM_148162	F029958	VLTTLKWAPTFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV*