Metagenome / Metatranscriptome Family F029958

Overview

Basic Information

• Family ID: F029958
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 186
• Average Sequence Length: 38 residues
• Representative Sequence: APTFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV
• Number of Associated Samples: 89
• Number of Associated Scaffolds: 186

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.54 %
• % of genes near scaffold ends (potentially truncated): 96.77 %
• % of genes from short scaffolds (< 2000 bps): 100.00 %
• Associated GOLD sequencing projects: 89
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (99.462 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (60.753 % of family members)
• Environment Ontology (ENVO): Unclassified (87.097 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (84.409 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 33.85%
  β-sheet: 0.00%
  Coil/Unstructured: 66.15%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
All Organisms	root	All Organisms	0.54 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
cellular organisms	root	All Organisms → cellular organisms	0.54 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.54 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.54 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.54 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.54 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.54 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.54 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.54 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.54 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.54 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.54 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.54 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.54 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.54 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.54 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.54 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.54 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.54 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.54 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.54 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.54 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.54 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.54 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.46 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.54 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001221|SwM_14816	Not Available	613
3300005365|Ga0070688_101008829	Not Available	661
3300005544|Ga0070686_101049970	Not Available	670
3300005617|Ga0068859_101809728	Not Available	674
3300005719|Ga0068861_101490162	Not Available	663
3300005719|Ga0068861_101685017	Not Available	627
3300005841|Ga0068863_101409811	Not Available	704
3300005841|Ga0068863_102177255	Not Available	564
3300005841|Ga0068863_102301609	Not Available	548
3300005841|Ga0068863_102521025	Not Available	523
3300005842|Ga0068858_101041529	Not Available	802
3300005842|Ga0068858_101730299	Not Available	617
3300005842|Ga0068858_102093651	Not Available	559
3300005842|Ga0068858_102152035	Not Available	551
3300005843|Ga0068860_101439206	Not Available	710
3300005843|Ga0068860_102283675	Not Available	561
3300005843|Ga0068860_102324147	Not Available	556
3300005843|Ga0068860_102686329	Not Available	516
3300005843|Ga0068860_102801150	Not Available	505
3300009981|Ga0105133_110391	Not Available	701
3300009992|Ga0105120_1030113	Not Available	641
3300010371|Ga0134125_12071601	Not Available	619
3300010371|Ga0134125_13110724	Not Available	503
3300010396|Ga0134126_12148814	Not Available	609
3300010399|Ga0134127_11931133	Not Available	668
3300012521|Ga0134099_1084775	Not Available	703
3300014968|Ga0157379_11934285	Not Available	582
3300015270|Ga0182183_1047558	Not Available	628
3300015270|Ga0182183_1048737	Not Available	623
3300015270|Ga0182183_1083281	Not Available	525
3300015273|Ga0182102_1045657	Not Available	508
3300015278|Ga0182099_1014676	Not Available	780
3300015280|Ga0182100_1033977	Not Available	722
3300015284|Ga0182101_1073700	Not Available	561
3300015284|Ga0182101_1079280	Not Available	547
3300015284|Ga0182101_1084302	Not Available	535
3300015293|Ga0182103_1054352	Not Available	623
3300015293|Ga0182103_1101690	Not Available	505
3300015297|Ga0182104_1117155	Not Available	508
3300015301|Ga0182184_1055459	Not Available	618
3300015309|Ga0182098_1063184	Not Available	645
3300015310|Ga0182162_1062031	Not Available	660
3300015310|Ga0182162_1066648	Not Available	644
3300015311|Ga0182182_1069921	Not Available	616
3300015311|Ga0182182_1095753	Not Available	550
3300015311|Ga0182182_1097227	Not Available	547
3300015312|Ga0182168_1028640	Not Available	881
3300015312|Ga0182168_1080867	Not Available	618
3300015313|Ga0182164_1111647	Not Available	546
3300015315|Ga0182120_1020233	Not Available	991
3300015315|Ga0182120_1099200	Not Available	575
3300015315|Ga0182120_1120976	Not Available	532
3300015316|Ga0182121_1091782	Not Available	609
3300015317|Ga0182136_1043445	Not Available	775
3300015317|Ga0182136_1056979	Not Available	707
3300015317|Ga0182136_1078648	Not Available	630
3300015317|Ga0182136_1102743	Not Available	570
3300015317|Ga0182136_1140009	Not Available	504
3300015318|Ga0182181_1059418	Not Available	634
3300015319|Ga0182130_1081398	Not Available	611
3300015319|Ga0182130_1104470	Not Available	558
3300015320|Ga0182165_1130875	Not Available	528
3300015322|Ga0182110_1064355	Not Available	619
3300015325|Ga0182148_1076318	Not Available	644
3300015325|Ga0182148_1084165	Not Available	621
3300015325|Ga0182148_1098452	Not Available	587
3300015327|Ga0182114_1075573	Not Available	685
3300015328|Ga0182153_1097123	Not Available	602
3300015329|Ga0182135_1110012	Not Available	577
3300015329|Ga0182135_1142117	Not Available	521
3300015330|Ga0182152_1081669	Not Available	648
3300015330|Ga0182152_1101916	Not Available	595
3300015330|Ga0182152_1115225	Not Available	567
3300015330|Ga0182152_1130999	Not Available	538
3300015331|Ga0182131_1097128	Not Available	609
3300015332|Ga0182117_1071955	Not Available	719
3300015333|Ga0182147_1026642	Not Available	1000
3300015333|Ga0182147_1039573	Not Available	878
3300015333|Ga0182147_1113915	Not Available	594
3300015334|Ga0182132_1064058	Not Available	744
3300015334|Ga0182132_1090626	Not Available	652
3300015334|Ga0182132_1134453	Not Available	555
3300015334|Ga0182132_1146584	Not Available	535
3300015335|Ga0182116_1152260	Not Available	542
3300015335|Ga0182116_1170122	Not Available	515
3300015337|Ga0182151_1062934	Not Available	734
3300015337|Ga0182151_1125880	Not Available	564
3300015337|Ga0182151_1126885	Not Available	563
3300015337|Ga0182151_1151320	Not Available	523
3300015340|Ga0182133_1121590	Not Available	614
3300015340|Ga0182133_1122310	Not Available	612
3300015340|Ga0182133_1155368	Not Available	552
3300015348|Ga0182115_1261220	Not Available	550
3300015348|Ga0182115_1284941	Not Available	522
3300015349|Ga0182185_1063834	Not Available	999
3300015352|Ga0182169_1067436	Not Available	1107
3300015352|Ga0182169_1191160	Not Available	669
3300015352|Ga0182169_1217974	Not Available	623
3300015352|Ga0182169_1226922	Not Available	609
3300015352|Ga0182169_1236567	Not Available	595
3300015352|Ga0182169_1279451	Not Available	540
3300015353|Ga0182179_1177097	Not Available	673
3300015353|Ga0182179_1206222	Not Available	627
3300015353|Ga0182179_1207480	Not Available	625
3300015353|Ga0182179_1221546	Not Available	606
3300015353|Ga0182179_1263883	Not Available	557
3300015353|Ga0182179_1305067	Not Available	518
3300015354|Ga0182167_1197215	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	737
3300015354|Ga0182167_1202585	Not Available	726
3300015354|Ga0182167_1257828	Not Available	627
3300015354|Ga0182167_1262712	Not Available	620
3300015354|Ga0182167_1323462	Not Available	543
3300015354|Ga0182167_1326002	Not Available	541
3300017414|Ga0182195_1103723	Not Available	681
3300017414|Ga0182195_1205820	Not Available	518
3300017422|Ga0182201_1037329	Not Available	792
3300017422|Ga0182201_1116875	Not Available	542
3300017432|Ga0182196_1054190	Not Available	724
3300017432|Ga0182196_1062481	Not Available	691
3300017439|Ga0182200_1053066	Not Available	744
3300017439|Ga0182200_1166362	Not Available	500
3300017445|Ga0182198_1089343	Not Available	690
3300017445|Ga0182198_1133535	Not Available	593
3300017445|Ga0182198_1145875	Not Available	574
3300017445|Ga0182198_1162361	Not Available	550
3300017445|Ga0182198_1166104	Not Available	545
3300017691|Ga0182212_1140335	Not Available	549
3300017692|Ga0182210_1104370	Not Available	612
3300017692|Ga0182210_1157313	Not Available	507
3300017693|Ga0182216_1039604	Not Available	971
3300017693|Ga0182216_1065252	Not Available	814
3300017693|Ga0182216_1096736	Not Available	703
3300017693|Ga0182216_1109474	Not Available	670
3300017693|Ga0182216_1167318	Not Available	566
3300017693|Ga0182216_1184960	Not Available	543
3300017693|Ga0182216_1193247	Not Available	534
3300017694|Ga0182211_1139770	Not Available	574
3300020023|Ga0182178_1012786	Not Available	614
3300026095|Ga0207676_11479382	Not Available	676
3300028050|Ga0268328_1064407	Not Available	523
3300028050|Ga0268328_1066081	Not Available	518
3300028051|Ga0268344_1010283	Not Available	668
3300028051|Ga0268344_1019201	Not Available	555
3300028053|Ga0268346_1020702	Not Available	643
3300028053|Ga0268346_1040348	Not Available	519
3300028054|Ga0268306_1016127	Not Available	647
3300028055|Ga0268338_1008198	Not Available	836
3300028056|Ga0268330_1016626	Not Available	793
3300028057|Ga0268352_1028519	Not Available	608
3300028057|Ga0268352_1040715	Not Available	519
3300028058|Ga0268332_1013725	Not Available	905
3300028058|Ga0268332_1035478	Not Available	673
3300028058|Ga0268332_1042649	Not Available	633
3300028058|Ga0268332_1050148	Not Available	597
3300028058|Ga0268332_1051296	Not Available	592
3300028058|Ga0268332_1064417	Not Available	544
3300028062|Ga0268342_1028920	Not Available	585
3300028062|Ga0268342_1034120	Not Available	553
3300028063|Ga0268350_1046495	Not Available	631
3300028139|Ga0268355_1017982	Not Available	512
3300028142|Ga0268347_1011778	Not Available	701
3300028142|Ga0268347_1013071	Not Available	680
3300028142|Ga0268347_1021936	Not Available	582
3300028142|Ga0268347_1024228	Not Available	564
3300028154|Ga0268341_1017506	Not Available	607
3300028154|Ga0268341_1018489	Not Available	598
3300028248|Ga0268312_1024079	Not Available	585
3300028262|Ga0268310_1003583	Not Available	1158
3300028262|Ga0268310_1009702	Not Available	863
3300028262|Ga0268310_1011490	Not Available	820
3300028262|Ga0268310_1024687	Not Available	647
3300028262|Ga0268310_1037146	Not Available	566
3300028466|Ga0268321_104611	Not Available	655
3300028468|Ga0268317_1011067	Not Available	531
3300028469|Ga0268337_1004418	Not Available	775
3300028472|Ga0268315_1002427	Not Available	1016
3300028472|Ga0268315_1009089	Not Available	708
3300028472|Ga0268315_1011312	Not Available	663
3300028473|Ga0268319_1017477	Not Available	558
3300028474|Ga0268331_1018349	Not Available	577
3300028475|Ga0268327_1015533	Not Available	599
3300028523|Ga0268313_1007449	Not Available	670
3300028523|Ga0268313_1018711	Not Available	516
3300032465|Ga0214493_1110490	Not Available	650
3300032502|Ga0214490_1162340	Not Available	502
3300032760|Ga0314754_1062753	Not Available	578

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	96.24%
Environmental	Environmental	3.23%
Engineered	Engineered	0.54%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	96.24%
Terrestrial	Environmental → Terrestrial	3.23%
Bioreactor	Engineered → Bioreactor	0.54%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	84.95%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.14%
Soil	Environmental → Terrestrial → Soil	3.23%
Unclassified	Host-Associated → Plants → Unclassified	1.08%
Roots	Host-Associated → Plants → Roots	0.54%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.54%
Unclassified	Engineered → Bioreactor → Unclassified	0.54%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	84.95%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.14%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.15%
Loam	Environmental → Terrestrial → Soil → Loam	1.08%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	1.08%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.54%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.54%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.54%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	84.95%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.14%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	2.15%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.08%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	1.08%
Unclassified	Host-Associated → Plants → Roots → Rhizosphere → Unclassified	0.54%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.54%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.54%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	60.75%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	23.66%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	9.14%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.15%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.08%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	1.08%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Switchgrass Rhizosphere	0.54%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.54%
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	0.54%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.54%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001221	Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_2	Host-Associated
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300012521	Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 10_41_5_180_A2 metaG	Engineered
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated
3300028055	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1	Host-Associated
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated
3300028057	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1	Host-Associated
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated
3300028062	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1	Host-Associated
3300028063	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1	Host-Associated
3300028139	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1	Host-Associated
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated
3300028466	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1	Host-Associated
3300028468	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1	Host-Associated
3300028469	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1	Host-Associated
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated
3300028474	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1	Host-Associated
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated
3300028523	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1	Host-Associated
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032760	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
SwM_148162	3300001221	Switchgrass Rhizosphere	VLTTLKWAPTFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV*
Ga0070688_1010088291	3300005365	Switchgrass Rhizosphere	LKWAPTFSLIYYEQVALLDPPNQLASDETEEFLPKHVPHV*
Ga0070686_1010499701	3300005544	Switchgrass Rhizosphere	TTLKWAPTFSSIYYEQVALLHPLNRLAFDKTEEILPKHVPHD*
Ga0068859_1018097281	3300005617	Switchgrass Rhizosphere	TFSSIYYEQVALLHPPNRLASDETKEFLPKHVPHV*
Ga0068861_1014901622	3300005719	Switchgrass Rhizosphere	MFSSIYYEQVALLHPPNRLASDETKEFLPKHVPHV*
Ga0068861_1016850171	3300005719	Switchgrass Rhizosphere	VLTTLKWAPMFSSIYYEQVALLHSSNRLASDETKEFFPKHVPHV*
Ga0068863_1014098111	3300005841	Switchgrass Rhizosphere	MKWAPTFSSIYYEQVALLHPPNRLASDETEEFLTKH
Ga0068863_1021772551	3300005841	Switchgrass Rhizosphere	FSSIYYEQVALLHPPNRQASDETEEFLPKHIPHV*
Ga0068863_1023016092	3300005841	Switchgrass Rhizosphere	KWAPTFSSIYYEHVALLHPPNRLASDETEEFLPKHVTHV*
Ga0068863_1025210251	3300005841	Switchgrass Rhizosphere	LKWAPTFSLIYYELVALLHPPNRLATDEPEEFLPKHVPHV*
Ga0068858_1010415292	3300005842	Switchgrass Rhizosphere	LKWAPTVSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV*
Ga0068858_1017302991	3300005842	Switchgrass Rhizosphere	LKWAPTFSSIYYEQVALLHPPIRLASDETEEFLPKNVPHV*
Ga0068858_1020936512	3300005842	Switchgrass Rhizosphere	LITLKWAPMFSLIYYEQVALLDPPNRLASDETEEFLPKHVPHV*
Ga0068858_1021520351	3300005842	Switchgrass Rhizosphere	MNWAPMFSSIYYELVALLHLPNRLASDETEEFLPKHVP
Ga0068860_1014392061	3300005843	Switchgrass Rhizosphere	MAPTFSSIYYEQVALLHPPNRLASDETEEFLPKHVP
Ga0068860_1022836752	3300005843	Switchgrass Rhizosphere	WAPTFSSIYYEQVALLHPPNRLASDETEEFLPKHLPHV*
Ga0068860_1023241472	3300005843	Switchgrass Rhizosphere	MFSSIYYEQVALLHPPIRLASDETEEFLPKHVPHV*
Ga0068860_1026863291	3300005843	Switchgrass Rhizosphere	PTFSSIYYEQVALLHPPNRLASDETEEFLPKHVPLV*
Ga0068860_1028011502	3300005843	Switchgrass Rhizosphere	LKWAPTFSSIYYEQVALLHPPIRLAFDETEEFLSK
Ga0105133_1103911	3300009981	Switchgrass Associated	FSSIYYEQVALLHLPNRVASDKTEGVLPKLVPHI*
Ga0105120_10301131	3300009992	Switchgrass Associated	PTVSAIYYEQVALLHPPNRLASDETEEFLPKHVPHV*
Ga0134125_120716011	3300010371	Terrestrial Soil	FSLIYYDLVALLHPPNRLATDEPEEFLPKHVPHV*
Ga0134125_131107241	3300010371	Terrestrial Soil	TFSSIYYDQVALLHPPNQLASDETEEFLSKHVQHV*
Ga0134126_121488141	3300010396	Terrestrial Soil	LKWAPIFSSIYSEQVALLHPPNGLASDETDEFLAKHVPHV*
Ga0134127_119311331	3300010399	Terrestrial Soil	TFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV*
Ga0134099_10847751	3300012521	Switchgrass Degrading	MKWAPTFSLIYYEQVALLHPPNRLASDETKEFLHKH
Ga0157379_119342851	3300014968	Switchgrass Rhizosphere	APTFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV*
Ga0182183_10475581	3300015270	Switchgrass Phyllosphere	FSSIYYEQVALLHPPNRLASNETEEFLPKHVPRV*
Ga0182183_10487371	3300015270	Switchgrass Phyllosphere	TLKWGPTFSSIYYEQVALLHPPNRLASDETEEFLPKPIPHV*
Ga0182183_10832811	3300015270	Switchgrass Phyllosphere	FASIYYEQVALLHPPNKLASDETEEFLPKHVPHV*
Ga0182102_10456571	3300015273	Switchgrass Phyllosphere	KWAPKILSIYYELVALLHPPKRQASDETVEFLPKHVPHV*
Ga0182099_10146761	3300015278	Switchgrass Phyllosphere	APTFSSIYVEQVALLHRPNQLASDETEEFLPKHVPHV*
Ga0182100_10339771	3300015280	Switchgrass Phyllosphere	LTTLKWAPTFSSIYYEQVALLHPPNRLASDETEEFLPKHVLRV*
Ga0182101_10737001	3300015284	Switchgrass Phyllosphere	IIVLITLKWAPTFSSIYYEQVAMFHPPNQLASDETEEFLPKHVPHV*
Ga0182101_10792801	3300015284	Switchgrass Phyllosphere	TFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHI*
Ga0182101_10843021	3300015284	Switchgrass Phyllosphere	PTFSSIYYEQVALLHLPNRLASDETEEFLPKHVHVPHV*
Ga0182103_10543521	3300015293	Switchgrass Phyllosphere	LKWAPTFSSIYYEQVVLLHPPNRLASDETEEILPKHVPPV*
Ga0182103_11016901	3300015293	Switchgrass Phyllosphere	LKWAPTFSSIYVELVALLHQPNQLASDETEEFLPKHVPHV
Ga0182104_11171551	3300015297	Switchgrass Phyllosphere	MFSSIYYEQVALLHPPNRQASDETEKFLPKHIPHV
Ga0182184_10554591	3300015301	Switchgrass Phyllosphere	KRAPTFSSIYYEQVALLHPPNRLASDETKEFKPKHVPHV*
Ga0182098_10631841	3300015309	Switchgrass Phyllosphere	KWAPTFSSIYYEQVALLHPPNFLAFDDTEEFLPKHVPHV*
Ga0182162_10620311	3300015310	Switchgrass Phyllosphere	LKWAPTFSSIYYEQVALLHPATRLASDETEEFLPKH
Ga0182162_10666481	3300015310	Switchgrass Phyllosphere	PTFSSIYYEQVALLHPPIRLASDETEEFLPKHVPHV*
Ga0182182_10699211	3300015311	Switchgrass Phyllosphere	KWAPTFSSIYYEQVALLHPPNRLASNETEEFLPKRVPRV*
Ga0182182_10957531	3300015311	Switchgrass Phyllosphere	VLSTLKWAPTFSSIYYEQVALLHPPNRLASDETEEFLPKHVPH
Ga0182182_10972271	3300015311	Switchgrass Phyllosphere	WAPTFTSIYYELVALLHPPNRLASDETEEFWPKHVPYV*
Ga0182168_10286401	3300015312	Switchgrass Phyllosphere	FSSIYYEQVALLHPPN*LASDETEEFLPKHVTYV*
Ga0182168_10808671	3300015312	Switchgrass Phyllosphere	TLKWAPTFSLIYYDLVALLHPPNRLATDEPEEFLPKHVPHV*
Ga0182164_11116472	3300015313	Switchgrass Phyllosphere	VLTTMKWAPTFSSIHYEQVALLHPPNQLASNETKEFFA*
Ga0182120_10202331	3300015315	Switchgrass Phyllosphere	FTSIYYEQVALLHPPN*LASDETEEFLPKHIPHV*
Ga0182120_10992001	3300015315	Switchgrass Phyllosphere	WAPTFSLIYYEQEALLHPPNLLASNKTEEFLPKHFPHV*
Ga0182120_11209761	3300015315	Switchgrass Phyllosphere	MKWAPTFSSIHYEQVALLHPPNRLASYETEEFFAQ
Ga0182121_10917821	3300015316	Switchgrass Phyllosphere	IVLTTLKWAPTFSLIYYELVALLHPPNQIATDEPEEFLPKHVPHV*
Ga0182136_10434451	3300015317	Switchgrass Phyllosphere	LTSLKWAPMFSSIYYEQVALLQPPNRLASDETEEFLPNHVPHV*
Ga0182136_10569791	3300015317	Switchgrass Phyllosphere	WAPMFSSIYYEQVALLHTPNRLASDETEEFLPKHVPHI*
Ga0182136_10786481	3300015317	Switchgrass Phyllosphere	SLKWAPTFSSIYYEQVALLHPPNRLASDETEEFLPKQVPHV*
Ga0182136_11027431	3300015317	Switchgrass Phyllosphere	TTLKWAPIFSSIYYEQVALLHKPNRQASGETEEFLPKNVPHV*
Ga0182136_11400091	3300015317	Switchgrass Phyllosphere	LKWAPTFSSIYYEQVALKHPYNRLASDETKGFLPKHIPHA*
Ga0182181_10594181	3300015318	Switchgrass Phyllosphere	TLKWAPTFSSIYYEQVALLHLPNRLASDETEEFLAKHVPHV*
Ga0182130_10813981	3300015319	Switchgrass Phyllosphere	APTFSSIYYEQEALLHPPNLLASDKTEEFLPKHVAHV*
Ga0182130_11044701	3300015319	Switchgrass Phyllosphere	WAPMFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV*
Ga0182165_11308751	3300015320	Switchgrass Phyllosphere	PTFSSIYYEQVALLHPPNRLASDETEEFLPKHVPRV*
Ga0182110_10643551	3300015322	Miscanthus Phyllosphere	FSSIYYEQVALLHPPSRLASDETEEFLPKHVPNI*
Ga0182148_10763181	3300015325	Switchgrass Phyllosphere	PTFTSIYYELVALLHPPNRLASDETEEFWPKHVPYV*
Ga0182148_10841651	3300015325	Switchgrass Phyllosphere	WAPTFSSIYYEQVALLHPPNRLASDETEEFLPQHAPHV*
Ga0182148_10984521	3300015325	Switchgrass Phyllosphere	PTFSSIYYEQVALLHPPNQLASDETEEFLPKHVPHV*
Ga0182114_10755731	3300015327	Switchgrass Phyllosphere	TLKWAPMFTSIYYEQVALLHPPNRLASDETEEFVPKHVPHV*
Ga0182153_10971231	3300015328	Switchgrass Phyllosphere	VLTTLKWAPMFSSIYYEQVALLHPPNRLASDETEEF*
Ga0182135_11100121	3300015329	Switchgrass Phyllosphere	FSLIYYEQVALLDPPNRLASDETEEFLPKHIPHV*
Ga0182135_11421171	3300015329	Switchgrass Phyllosphere	TFSSIYYEQVALLHPPKRLASDETEEFLPNHIPQV*
Ga0182152_10816691	3300015330	Switchgrass Phyllosphere	LKWAPTFSYIYYEQLALLHPPNRLASDETEEFLPKHVPHV*
Ga0182152_11019161	3300015330	Switchgrass Phyllosphere	FSSIYYEQVALLHPPNRLASDETKEFLLKHVPHV*
Ga0182152_11152251	3300015330	Switchgrass Phyllosphere	APTFSSIYYEQVALLHPPNRLASDEIEKFLPKHIPHV*
Ga0182152_11309992	3300015330	Switchgrass Phyllosphere	SPYHIDMAPTFSSIYYEHVALLLPPNRLASDETEEFLPKHVPYV*
Ga0182131_10971281	3300015331	Switchgrass Phyllosphere	FSLIYYELVALLHPPNRLATDEPEEFLPKHVPHV*
Ga0182117_10719551	3300015332	Switchgrass Phyllosphere	TLKWAPTVSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV*
Ga0182147_10266421	3300015333	Switchgrass Phyllosphere	LKWAPTFSSIYYEQVALLHPPNRQASDETEKFLPKHIPHV*
Ga0182147_10395731	3300015333	Switchgrass Phyllosphere	FSLIYYEQVALLHPPNRLASDETEEFLPKYVPHA*
Ga0182147_11139151	3300015333	Switchgrass Phyllosphere	LKWAPTFSSIYYEQVALLHPPNRLASDETEDFLPKHVPHV*
Ga0182132_10640581	3300015334	Switchgrass Phyllosphere	LTTLKWAPTFSSIYYEQVALLHPPNRLASDETEEFLPKHVLHV*
Ga0182132_10906261	3300015334	Switchgrass Phyllosphere	APTFSSIYYEQAALLYLPNRQASDETEEFFPKHVPHI*
Ga0182132_11344531	3300015334	Switchgrass Phyllosphere	FSSIYYEQVALLHLPIRLASKETEEFLPKHVPHV*
Ga0182132_11465841	3300015334	Switchgrass Phyllosphere	TTLKWAPTFSSIYYEQVALLHLPNRLASDENEEFLPKHVPHV*
Ga0182116_11522601	3300015335	Switchgrass Phyllosphere	IVLKSLKWAPTFSSIYYEQVALLHPPNLLASDETEEFLPKHVPYV*
Ga0182116_11701221	3300015335	Switchgrass Phyllosphere	TFSSIYYDLVDLLHPPSGLASDENEEFLPKHVPHV*
Ga0182151_10629341	3300015337	Switchgrass Phyllosphere	VLTTLKWAPTFSSIYYEQVALLHPPIRLASDETEEFLPKHFPHV*
Ga0182151_11258801	3300015337	Switchgrass Phyllosphere	PTFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV*
Ga0182151_11268852	3300015337	Switchgrass Phyllosphere	TTLKWAPTFSSIYYEQVALLRLPKRQASNETDEFLPKHGPHV*
Ga0182151_11513201	3300015337	Switchgrass Phyllosphere	MFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHVYKDHIGK
Ga0182133_11215901	3300015340	Switchgrass Phyllosphere	TFSSIYVEQVALLHPPNQLAYGETEEFLPKHIPHV*
Ga0182133_11223101	3300015340	Switchgrass Phyllosphere	PTFSSIYYEQVALLHPSNRLASDETEEFLPKHVPCV*
Ga0182133_11553681	3300015340	Switchgrass Phyllosphere	MFSSIYYEQVVLLHPPNRLASDETEEILPKHVPHV
Ga0182115_12612201	3300015348	Switchgrass Phyllosphere	MKWAPTFSSIYYEHVALLHPPNRLASDETEEFLPKH
Ga0182115_12849411	3300015348	Switchgrass Phyllosphere	FSSIYYEQVALLHPPNRLASNETEEFLPKQVPHV*
Ga0182185_10638341	3300015349	Switchgrass Phyllosphere	IVLTTLKWAPTLSSIYYEQVALLHPPNRLASDETKDFLPKHVPHV*
Ga0182169_10674361	3300015352	Switchgrass Phyllosphere	LKWAPTFSSIYVEQVALLHRPNQLASNETEEFLPKHVPHV*
Ga0182169_11911601	3300015352	Switchgrass Phyllosphere	TFSSIYYEQVALLHPPNRLASDETEEFLPKHVPQV*
Ga0182169_12179741	3300015352	Switchgrass Phyllosphere	FSSIYYEQVALLHPPNRLASDETKEFLPKHVPHV*
Ga0182169_12269221	3300015352	Switchgrass Phyllosphere	KWAPTFSSIYYEQVALLHPPNRLASDETEEFLPKPIPHV*
Ga0182169_12365671	3300015352	Switchgrass Phyllosphere	KWAPTFLSIYYEQVALLHPPNRLASDETEEFLPKHIPHV*
Ga0182169_12794511	3300015352	Switchgrass Phyllosphere	MFSSIYYEQVALLHPPNRLASDETEEFLPKHIPHV
Ga0182179_11770971	3300015353	Switchgrass Phyllosphere	TLKWAPTFSSIYYEQVALLHPPNRLASDETVEFLLKHVPHV*
Ga0182179_12062221	3300015353	Switchgrass Phyllosphere	KWTPTFSSIYYEQVALKHPHNRLASDETKEFLPKHVPHA*
Ga0182179_12074801	3300015353	Switchgrass Phyllosphere	APTFSSIYYEQVALLDPPNRLASNETEEFLPKHVPHF*
Ga0182179_12215461	3300015353	Switchgrass Phyllosphere	FSSIYYEQVALLLPPNRLASDETEEFLPKHVPLV*
Ga0182179_12638831	3300015353	Switchgrass Phyllosphere	FSLIYYEQVALLHPPNRLASDETEEFLPKHVPHV*
Ga0182179_13050671	3300015353	Switchgrass Phyllosphere	FSSIYYEQVALLHPPIRLASDETKEFMPKHVPHV*
Ga0182167_11972151	3300015354	Switchgrass Phyllosphere	PTFSLIYYEQVALLHPPNRLAFNETEGFLPKHVPHI*
Ga0182167_12025851	3300015354	Switchgrass Phyllosphere	TTLKWAPTFSSIYYEQVALLHPPIRLASDETEEFLPKHFPHV*
Ga0182167_12578281	3300015354	Switchgrass Phyllosphere	TFSSIYYEQVALLHPPN*LASDETEEFLPKHVTYV*
Ga0182167_12627121	3300015354	Switchgrass Phyllosphere	TLKWAPTFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV*
Ga0182167_13234622	3300015354	Switchgrass Phyllosphere	TTLKWAPTFSSIYYEQVALLHPPNRLASDEIEEILPKHIP*
Ga0182167_13260021	3300015354	Switchgrass Phyllosphere	IIVLTTLKWAPTFSLIYYELVALLHPPNQLATDEPEEFLPKHVPHV*
Ga0182195_11037231	3300017414	Switchgrass Phyllosphere	TLKWAPTFSSIYYEQVALLHPPNRLASDETEEILTKHVPHV
Ga0182195_12058201	3300017414	Switchgrass Phyllosphere	TLKWAPTFSLIYYDLVALLHPPNRLATDEPEEFLPKHVPHV
Ga0182201_10373291	3300017422	Switchgrass Phyllosphere	TFSPIYYEQVALLHPPNRLASVETEEFLPKHIPHV
Ga0182201_11168751	3300017422	Switchgrass Phyllosphere	PTFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV
Ga0182196_10541901	3300017432	Switchgrass Phyllosphere	APTFSSIYYEQVALLHPPNRLASDETEEFLPKHIPHV
Ga0182196_10624811	3300017432	Switchgrass Phyllosphere	KWAPMFSSIYYEQVALLHPPNQLASDETEEFLPKHIPHV
Ga0182200_10530661	3300017439	Switchgrass Phyllosphere	TVLTTLKWAPTFSSIYYEQVALLHPPNQLASDETEEFLRKHVPHV
Ga0182200_11663621	3300017439	Switchgrass Phyllosphere	ITILKWAPMLSLIYYEQVALLHPLNRLASDETKEFLPKHLPHV
Ga0182198_10893431	3300017445	Switchgrass Phyllosphere	LKWAPTFLSIYYEQVALLHPPNRLASDETEEFLPKHAPHV
Ga0182198_11335351	3300017445	Switchgrass Phyllosphere	PTFSSIYYEQVALLQTPNQLASDETEEFLPKHVPRV
Ga0182198_11458751	3300017445	Switchgrass Phyllosphere	MGTYVLIYLLWFSYIYYEQLALLHPPNQLASDETEEFLPKHV
Ga0182198_11623611	3300017445	Switchgrass Phyllosphere	APTFSSIYYEQVALLHPPNRLASDETEEFLPKHVRHV
Ga0182198_11661041	3300017445	Switchgrass Phyllosphere	PTFSSIYYEHVALLHPPNRLASDETEEFLSKHVPHV
Ga0182212_11403352	3300017691	Switchgrass Phyllosphere	KWAPTFSSIYYEQVALLHPPNRLASDETEQFLPKHIPHV
Ga0182210_11043701	3300017692	Switchgrass Phyllosphere	LKWAPTFSSIYYEQVALLHPPNRLASDETEEFLPKHVSHV
Ga0182210_11573131	3300017692	Switchgrass Phyllosphere	TFSSIYYEQVALLRPPNRLASDETVEFLPKHVPHV
Ga0182216_10396041	3300017693	Switchgrass Phyllosphere	TFSSIYYEQVALLHPPNRLASDETEEFLPKHVPQV
Ga0182216_10652521	3300017693	Switchgrass Phyllosphere	APMFSSIYYEQVALLQPPNRLASDETEEFLPNHVPHV
Ga0182216_10967361	3300017693	Switchgrass Phyllosphere	KWAPTFSSIYYEQVALLHPPNRLASDETVEILPKHVPHV
Ga0182216_11094741	3300017693	Switchgrass Phyllosphere	LTTLKWAPTFSSIYYEQVALLHPPNRLTSVETEEFFPKHVPYV
Ga0182216_11673181	3300017693	Switchgrass Phyllosphere	WAPTFSSIYYEQVALLHPPNRLASYETEEFLPKHILHV
Ga0182216_11849601	3300017693	Switchgrass Phyllosphere	TLKWAPTFSSIYYEQVALLHPPNRLASDEIEEILPKHIP
Ga0182216_11932471	3300017693	Switchgrass Phyllosphere	APTFSSIYYEQVVLLHPPNRLASDETEEILPKHVTHV
Ga0182211_11397701	3300017694	Switchgrass Phyllosphere	TLSSIYYEQVALLHPPNLLASNETEEFLPKHVPHV
Ga0182178_10127861	3300020023	Switchgrass Phyllosphere	KWAPTFPSIYYEQVALLHPPNQLASEETEEFLPKHVPHV
Ga0207676_114793821	3300026095	Switchgrass Rhizosphere	APTFSSIYCEQVALLHPPNQLASDETEDFLFKHVPHV
Ga0268328_10644071	3300028050	Phyllosphere	MFSSIYYEQVALLQLPNRLASDETEEFLPKHVPHV
Ga0268328_10660811	3300028050	Phyllosphere	VLITLKWAPTFSLIYYEQVALLDPPNQLASDETEEFLPKHVSHV
Ga0268344_10102831	3300028051	Phyllosphere	PTFSSIYYEQVALLHPPNRLASDETEEFLPKHIPHV
Ga0268344_10192011	3300028051	Phyllosphere	APMFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV
Ga0268346_10207021	3300028053	Phyllosphere	MFSSMYSEQVALLHPPNXLANDETEEFWPKHDPHI
Ga0268346_10403481	3300028053	Phyllosphere	MKWAPTFSYIYYEQVALLHPPNRLASDETEEFLPK
Ga0268306_10161271	3300028054	Phyllosphere	APTFSSIYYEQVALLHPPNRLASDETEEIFPKQVPHV
Ga0268338_10081981	3300028055	Phyllosphere	KWAPTFSSIYYEQVALLHPTNRLASDETEEFLPKHVPHD
Ga0268330_10166261	3300028056	Phyllosphere	VLTTLKWAPTFSSIYYEQVAVLHPPNRLASDETEEFLPKHIPHV
Ga0268352_10285191	3300028057	Phyllosphere	LKWAPTFSSIYVELVALLHRPNQLSSDETDEFMPKHVPHV
Ga0268352_10407151	3300028057	Phyllosphere	KLAPKLSSIYYEQVALLHPPNQLASDEIEEFLPKHVPHV
Ga0268332_10137252	3300028058	Phyllosphere	TRLKWAPTFSSIYYEQVALLHLPNRLASDETEEFLPKHVPHV
Ga0268332_10354781	3300028058	Phyllosphere	PTFSSIYYEQVALLHPPIRLASDETEEFLPKHVPHV
Ga0268332_10426491	3300028058	Phyllosphere	PTFSSIYYEQVALLHSPNRLASDETEEFLPKHIPHV
Ga0268332_10501481	3300028058	Phyllosphere	MKWAPTFSSIHYEQVALLHPPNRLASYETEEFFAQI
Ga0268332_10512961	3300028058	Phyllosphere	LKWAPTFSSIYYEQVVLLHAPNQLASDETEEFLPKRVPHV
Ga0268332_10644171	3300028058	Phyllosphere	PTFSSIYYEQVALLHPPIRLASSETEEFLPKHVQYV
Ga0268342_10289201	3300028062	Phyllosphere	ETATKFSSIYYEQVALLHPSNRLASDETEEFLPKHVPHV
Ga0268342_10341201	3300028062	Phyllosphere	MKWAPTFSSIHYEQVALLHPPNRLASYETEEFFAQTCSTC
Ga0268350_10464951	3300028063	Phyllosphere	KWAPTFSSIYYEQVALLHPPNRLASDETEEFFTKHIPHV
Ga0268355_10179821	3300028139	Phyllosphere	TFSSIYYEQVDLLHPPNQLASNETEEILSKHVPLV
Ga0268347_10117781	3300028142	Phyllosphere	LTTLKWAPTFSSIYYEQVALLHLSIRLASDETEEFLPKHVSHV
Ga0268347_10130711	3300028142	Phyllosphere	TSLKWEPMFSSIYYEQVALLHPPNRLASDETEEFLPNHVPQV
Ga0268347_10219361	3300028142	Phyllosphere	TFSSIYYAQVALLHPPNRLASDEIEEILPKHIPHV
Ga0268347_10242281	3300028142	Phyllosphere	KWAPTVSSIYYEQVALLHPPNRLASNETEEFLPKHVPYV
Ga0268341_10175061	3300028154	Phyllosphere	TLKWAPKLSSIYYEQVALLHPPNQLASDEIEEFLPKHVPHV
Ga0268341_10184891	3300028154	Phyllosphere	APTFSSIYYEQVALLHPPNRLASDETEEFLPNHVPHV
Ga0268312_10240791	3300028248	Phyllosphere	PMFSSIYYEQVALLHPSNQLASDETEEFLPKHIPHV
Ga0268310_10035831	3300028262	Phyllosphere	FFENIIVLTSLKWAPTFSSIYYEQVALLHLSIRLASDETEEFLPKHVSHV
Ga0268310_10097021	3300028262	Phyllosphere	TLKWAPTFLSIYYEQVALLHPPNRLASDETEEFLLKHIPLL
Ga0268310_10114901	3300028262	Phyllosphere	NSLVSSIYYEQVALLHPPNRLASDETKEFSPKHVPHV
Ga0268310_10246871	3300028262	Phyllosphere	MFSSIYYEQVALLHPPNXLASDETEEFLPKHVPRVYKDHIGK
Ga0268310_10371461	3300028262	Phyllosphere	MFSSIYYEHVALLHPPNRLASDETKEFLPKHVAHVY
Ga0268321_1046111	3300028466	Phyllosphere	TTLKWEPTFSSIYYEQVALLHPPNRLASDETEEFLPKHVPRV
Ga0268317_10110671	3300028468	Phyllosphere	VLTTLKWAPMFSSIYYEQVALLHPPNRLASDETEEF
Ga0268337_10044181	3300028469	Phyllosphere	KWAPMFSSIYYEQVALLHPPNQLASDETEEFLPKHVPLV
Ga0268315_10024271	3300028472	Phyllosphere	LKWAPTFSSIYYEQVALLHPPNRLASDETEEFLPKHIPHV
Ga0268315_10090891	3300028472	Phyllosphere	KWAPMFSSIYYEQVALLHPPNRLASDETKEFLPKHVPQV
Ga0268315_10113121	3300028472	Phyllosphere	KWAPTFSSIYYEQVALLHPPNLLASDETEEFLPKHIPHV
Ga0268319_10174771	3300028473	Phyllosphere	WAPTFLSIYYEPVALLHPPNRLASDETEEFLPKHVPHV
Ga0268331_10183491	3300028474	Phyllosphere	ITLKWAPMFSLIYYEQVALLDPPNRLASDETEEFLPKHVPHV
Ga0268327_10155331	3300028475	Phyllosphere	KWAPTFSSFYYEQVALLQPPNRLASDETEEFFPKHVPLV
Ga0268313_10074491	3300028523	Phyllosphere	TLKWAPTFSSIYYEQVALLHPPIRLVSDETKEFMPKHVPQV
Ga0268313_10187111	3300028523	Phyllosphere	LKWAPTFSSIYYEQVALLHLPNRLASDETEEFLPKHIPHV
Ga0214493_11104901	3300032465	Switchgrass Phyllosphere	LKWAPMFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV
Ga0214490_11623402	3300032502	Switchgrass Phyllosphere	KYAPMFSSIYYEQVGLLHPPSRLASDETEEFLPKHDPLV
Ga0314754_10627531	3300032760	Switchgrass Phyllosphere	EEWAPTFASIYYEQVALLHPPNRLASDQTEEFLPKHVPHV