x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300001156
3300001156: Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2
Overview
| Basic Information |
| IMG/M Taxon OID | 3300001156 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0071004 | Gp0054862 | Ga0002917 |
| Sample Name | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 2682431 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | forest biome → land → forest soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information |
| Location | Davy Crockett National Forest, Groveton, Texas, USA |
| Coordinates | Lat. (o) | 31.11 | Long. (o) | -95.15 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F023230 | Metagenome / Metatranscriptome | 211 | Y |
| F037452 | Metagenome / Metatranscriptome | 168 | Y |
| F055890 | Metagenome / Metatranscriptome | 138 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| JGI12706J13280_10102 | JGI12706J13280_101021 | F037452 | MESSFLIEVDNTSILRTGALHCYHYTLNRLPAPRLLLPRSGLERSDFVLWP |
| JGI12706J13280_10152 | JGI12706J13280_101521 | F055890 | MIMRFRPANISLINRRHYLPRLLLTLSSFEKNDQRILTGHYIS |
| JGI12706J13280_10247 | JGI12706J13280_102472 | F023230 | LQDQSGSVFEREGKVIGFSRRHRFESYLDKVFNFSSRVEALPEGRSYPQHSGKKIFDAVFLGAACQFRSVHRLERECQRGGALSKRIGSLSEDALGYALERYDSQAVFRLGCQVSRQLKRNGVFRSKWSRGLVVAAVDGIEICNSFVRFCDH |
