| Basic Information | |
|---|---|
| Family ID | F055890 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MRFRPANISLINRRHYLPRLLLTLSSIEKDDQRTLTGHYISTS |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 37.78 % |
| % of genes near scaffold ends (potentially truncated) | 83.33 % |
| % of genes from short scaffolds (< 2000 bps) | 68.12 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.159 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.188 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.580 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.203 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.85% β-sheet: 0.00% Coil/Unstructured: 59.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 47.83 |
| PF13924 | Lipocalin_5 | 7.25 |
| PF13570 | PQQ_3 | 2.90 |
| PF01548 | DEDD_Tnp_IS110 | 2.17 |
| PF11746 | DUF3303 | 1.45 |
| PF00903 | Glyoxalase | 1.45 |
| PF01833 | TIG | 1.45 |
| PF07589 | PEP-CTERM | 1.45 |
| PF07883 | Cupin_2 | 1.45 |
| PF10083 | DUF2321 | 1.45 |
| PF02321 | OEP | 0.72 |
| PF13358 | DDE_3 | 0.72 |
| PF00753 | Lactamase_B | 0.72 |
| PF02518 | HATPase_c | 0.72 |
| PF02687 | FtsX | 0.72 |
| PF08240 | ADH_N | 0.72 |
| PF01527 | HTH_Tnp_1 | 0.72 |
| PF07366 | SnoaL | 0.72 |
| PF03466 | LysR_substrate | 0.72 |
| PF00717 | Peptidase_S24 | 0.72 |
| PF04015 | DUF362 | 0.72 |
| PF12543 | DUF3738 | 0.72 |
| PF00654 | Voltage_CLC | 0.72 |
| PF00144 | Beta-lactamase | 0.72 |
| PF01619 | Pro_dh | 0.72 |
| PF01566 | Nramp | 0.72 |
| PF03448 | MgtE_N | 0.72 |
| PF00856 | SET | 0.72 |
| PF12680 | SnoaL_2 | 0.72 |
| PF00196 | GerE | 0.72 |
| PF07603 | DUF1566 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 50.00 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.45 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.72 |
| COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 0.72 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.72 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.72 |
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 0.72 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.72 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.16 % |
| Unclassified | root | N/A | 18.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig93343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 618 | Open in IMG/M |
| 3300001156|JGI12706J13280_10152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1036 | Open in IMG/M |
| 3300001867|JGI12627J18819_10028215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2315 | Open in IMG/M |
| 3300003152|Ga0052254_1098019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermabacteraceae → Brachybacterium → Brachybacterium fresconis | 619 | Open in IMG/M |
| 3300003368|JGI26340J50214_10030833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1589 | Open in IMG/M |
| 3300003370|JGI26337J50220_1031040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 611 | Open in IMG/M |
| 3300005548|Ga0070665_100736578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
| 3300006176|Ga0070765_100135331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2180 | Open in IMG/M |
| 3300006176|Ga0070765_101691418 | Not Available | 594 | Open in IMG/M |
| 3300009098|Ga0105245_11376593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 755 | Open in IMG/M |
| 3300009174|Ga0105241_10158782 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300009518|Ga0116128_1006760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 4259 | Open in IMG/M |
| 3300009518|Ga0116128_1079958 | Not Available | 986 | Open in IMG/M |
| 3300009519|Ga0116108_1001710 | All Organisms → cellular organisms → Bacteria | 11084 | Open in IMG/M |
| 3300009519|Ga0116108_1009452 | Not Available | 3741 | Open in IMG/M |
| 3300009519|Ga0116108_1070844 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300009519|Ga0116108_1082765 | Not Available | 983 | Open in IMG/M |
| 3300009548|Ga0116107_1114122 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300009551|Ga0105238_10269590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1683 | Open in IMG/M |
| 3300009634|Ga0116124_1070072 | Not Available | 1010 | Open in IMG/M |
| 3300009644|Ga0116121_1036042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1563 | Open in IMG/M |
| 3300009646|Ga0116132_1012977 | All Organisms → cellular organisms → Bacteria | 3214 | Open in IMG/M |
| 3300009760|Ga0116131_1010440 | Not Available | 3750 | Open in IMG/M |
| 3300009824|Ga0116219_10016089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4702 | Open in IMG/M |
| 3300009839|Ga0116223_10133362 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300010043|Ga0126380_11488034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 599 | Open in IMG/M |
| 3300010343|Ga0074044_10027459 | All Organisms → cellular organisms → Bacteria | 4042 | Open in IMG/M |
| 3300012971|Ga0126369_10840027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1002 | Open in IMG/M |
| 3300012987|Ga0164307_11310017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis → Terriglobus saanensis SP1PR4 | 606 | Open in IMG/M |
| 3300014151|Ga0181539_1005503 | All Organisms → cellular organisms → Bacteria | 10206 | Open in IMG/M |
| 3300014162|Ga0181538_10484763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300014167|Ga0181528_10900982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 500 | Open in IMG/M |
| 3300014168|Ga0181534_10239753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 959 | Open in IMG/M |
| 3300014199|Ga0181535_10005036 | All Organisms → cellular organisms → Bacteria | 14349 | Open in IMG/M |
| 3300014199|Ga0181535_10186860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1279 | Open in IMG/M |
| 3300014501|Ga0182024_11755279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 696 | Open in IMG/M |
| 3300015264|Ga0137403_10107295 | All Organisms → cellular organisms → Bacteria | 2796 | Open in IMG/M |
| 3300016404|Ga0182037_10104604 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
| 3300016422|Ga0182039_12221326 | Not Available | 506 | Open in IMG/M |
| 3300017925|Ga0187856_1006337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 7454 | Open in IMG/M |
| 3300017925|Ga0187856_1028035 | Not Available | 2728 | Open in IMG/M |
| 3300017925|Ga0187856_1064496 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300017925|Ga0187856_1127382 | Not Available | 981 | Open in IMG/M |
| 3300017931|Ga0187877_1112583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1124 | Open in IMG/M |
| 3300017931|Ga0187877_1369432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 543 | Open in IMG/M |
| 3300017935|Ga0187848_10309711 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300017938|Ga0187854_10099066 | Not Available | 1369 | Open in IMG/M |
| 3300017940|Ga0187853_10183790 | Not Available | 986 | Open in IMG/M |
| 3300017946|Ga0187879_10229002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1038 | Open in IMG/M |
| 3300017948|Ga0187847_10014062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5169 | Open in IMG/M |
| 3300018002|Ga0187868_1015128 | Not Available | 3865 | Open in IMG/M |
| 3300018004|Ga0187865_1045227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1800 | Open in IMG/M |
| 3300018013|Ga0187873_1131585 | Not Available | 966 | Open in IMG/M |
| 3300018016|Ga0187880_1146751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1112 | Open in IMG/M |
| 3300018020|Ga0187861_10018228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4311 | Open in IMG/M |
| 3300018026|Ga0187857_10103179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1386 | Open in IMG/M |
| 3300018026|Ga0187857_10223697 | Not Available | 872 | Open in IMG/M |
| 3300018034|Ga0187863_10007223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 7520 | Open in IMG/M |
| 3300018034|Ga0187863_10108058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1558 | Open in IMG/M |
| 3300018046|Ga0187851_10250534 | Not Available | 1038 | Open in IMG/M |
| 3300019886|Ga0193727_1100774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 851 | Open in IMG/M |
| 3300020583|Ga0210401_10062278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3513 | Open in IMG/M |
| 3300020583|Ga0210401_10079702 | All Organisms → cellular organisms → Bacteria | 3082 | Open in IMG/M |
| 3300021171|Ga0210405_10158467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1793 | Open in IMG/M |
| 3300021180|Ga0210396_10071925 | Not Available | 3147 | Open in IMG/M |
| 3300021180|Ga0210396_10189584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1839 | Open in IMG/M |
| 3300021180|Ga0210396_10694992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 879 | Open in IMG/M |
| 3300021401|Ga0210393_10014747 | Not Available | 6054 | Open in IMG/M |
| 3300021401|Ga0210393_10068889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2791 | Open in IMG/M |
| 3300021402|Ga0210385_10331034 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300021403|Ga0210397_10130120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1737 | Open in IMG/M |
| 3300021403|Ga0210397_10181867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus | 1491 | Open in IMG/M |
| 3300021404|Ga0210389_10122355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2010 | Open in IMG/M |
| 3300021404|Ga0210389_10509408 | Not Available | 947 | Open in IMG/M |
| 3300021405|Ga0210387_10475117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1110 | Open in IMG/M |
| 3300021406|Ga0210386_10235335 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300021407|Ga0210383_10014804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6575 | Open in IMG/M |
| 3300021407|Ga0210383_10183818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1784 | Open in IMG/M |
| 3300021420|Ga0210394_11294446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 623 | Open in IMG/M |
| 3300021432|Ga0210384_10269973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1531 | Open in IMG/M |
| 3300021433|Ga0210391_10185754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1635 | Open in IMG/M |
| 3300021433|Ga0210391_10783772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 745 | Open in IMG/M |
| 3300021474|Ga0210390_10012866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6805 | Open in IMG/M |
| 3300021474|Ga0210390_10061878 | All Organisms → cellular organisms → Bacteria | 3085 | Open in IMG/M |
| 3300021475|Ga0210392_10015116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4244 | Open in IMG/M |
| 3300021477|Ga0210398_10012462 | Not Available | 7463 | Open in IMG/M |
| 3300021477|Ga0210398_10075900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2731 | Open in IMG/M |
| 3300021478|Ga0210402_10037864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Eremiobacterota → unclassified Candidatus Eremiobacteraeota → Candidatus Eremiobacteraeota bacterium | 4191 | Open in IMG/M |
| 3300022593|Ga0236338_1019431 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300025412|Ga0208194_1017367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1160 | Open in IMG/M |
| 3300025419|Ga0208036_1024465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1189 | Open in IMG/M |
| 3300025442|Ga0208034_1042156 | Not Available | 1002 | Open in IMG/M |
| 3300025446|Ga0208038_1000805 | All Organisms → cellular organisms → Bacteria | 20713 | Open in IMG/M |
| 3300025446|Ga0208038_1021202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1562 | Open in IMG/M |
| 3300025446|Ga0208038_1038863 | Not Available | 975 | Open in IMG/M |
| 3300025473|Ga0208190_1016435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1772 | Open in IMG/M |
| 3300025477|Ga0208192_1027000 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300025480|Ga0208688_1070866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 709 | Open in IMG/M |
| 3300025500|Ga0208686_1055594 | Not Available | 913 | Open in IMG/M |
| 3300025911|Ga0207654_10017553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3744 | Open in IMG/M |
| 3300026942|Ga0207783_1003443 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
| 3300027330|Ga0207777_1011124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1884 | Open in IMG/M |
| 3300027371|Ga0209418_1083533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 573 | Open in IMG/M |
| 3300027497|Ga0208199_1060010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 806 | Open in IMG/M |
| 3300027629|Ga0209422_1021144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1617 | Open in IMG/M |
| 3300027768|Ga0209772_10011701 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300027824|Ga0209040_10110955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1537 | Open in IMG/M |
| 3300027854|Ga0209517_10140809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1557 | Open in IMG/M |
| 3300027867|Ga0209167_10096040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1511 | Open in IMG/M |
| 3300028015|Ga0265353_1001682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1541 | Open in IMG/M |
| 3300028379|Ga0268266_10498040 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300028381|Ga0268264_10056211 | All Organisms → cellular organisms → Bacteria | 3289 | Open in IMG/M |
| 3300028906|Ga0308309_10089989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2346 | Open in IMG/M |
| 3300028906|Ga0308309_11912959 | Not Available | 500 | Open in IMG/M |
| 3300030494|Ga0310037_10488786 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300030659|Ga0316363_10133546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300030878|Ga0265770_1012302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1266 | Open in IMG/M |
| 3300031010|Ga0265771_1014645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 622 | Open in IMG/M |
| 3300031231|Ga0170824_126126083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 810 | Open in IMG/M |
| 3300031231|Ga0170824_126574785 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300031446|Ga0170820_17421568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 974 | Open in IMG/M |
| 3300031474|Ga0170818_106668525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1132 | Open in IMG/M |
| 3300031573|Ga0310915_11006276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 581 | Open in IMG/M |
| 3300031680|Ga0318574_10098239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1620 | Open in IMG/M |
| 3300031708|Ga0310686_115979199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 3061 | Open in IMG/M |
| 3300031718|Ga0307474_10501819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 951 | Open in IMG/M |
| 3300031821|Ga0318567_10376119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 804 | Open in IMG/M |
| 3300031912|Ga0306921_11267745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 817 | Open in IMG/M |
| 3300032054|Ga0318570_10163404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 999 | Open in IMG/M |
| 3300032059|Ga0318533_10938499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 635 | Open in IMG/M |
| 3300032160|Ga0311301_10535568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1719 | Open in IMG/M |
| 3300032261|Ga0306920_102690383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 680 | Open in IMG/M |
| 3300032896|Ga0335075_10111866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3533 | Open in IMG/M |
| 3300033402|Ga0326728_10012013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 19487 | Open in IMG/M |
| 3300033405|Ga0326727_10016648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15457 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.19% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 15.22% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 15.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.07% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.07% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.35% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.45% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.72% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300001156 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022593 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W2 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025446 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026942 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 63 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0343.00005880 | 2166559005 | Simulated | MIMRFRPANISLINRRHYLPRLLLTLSSFEKNDQRILTGHYISL |
| JGI12706J13280_101521 | 3300001156 | Forest Soil | MIMRFRPANISLINRRHYLPRLLLTLSSFEKNDQRILTGHYIS |
| JGI12627J18819_100282151 | 3300001867 | Forest Soil | MRFRPANISLINRRHYLPRPLLTLSSIEKSNQRTLTGHYISLP |
| Ga0052254_10980191 | 3300003152 | Sediment | LINRRHYLPRLLLTLSSSEENDQRTLTGHYISGKSRRQLTRNTIHF |
| JGI26340J50214_100308333 | 3300003368 | Bog Forest Soil | MIMRFRPANISLINRRHYLPRLLLTLSSFEKNDQRILTGHYISLPD |
| JGI26337J50220_10310402 | 3300003370 | Bog Forest Soil | MIMRFRPANISLINRRHYLPRLLLTLSSFEKNDQRTLTGHYISFP |
| Ga0070665_1007365783 | 3300005548 | Switchgrass Rhizosphere | MIMRFRPANISLINRRHYLPRLLLFLSSNYENKNNLNHAQALTGHTISTDQ* |
| Ga0070765_1001353312 | 3300006176 | Soil | MIMRFRPANISLINRRHYLPRLLLTLSSKYNDKNNPNDLQILTGHTISGEE* |
| Ga0070765_1016914181 | 3300006176 | Soil | NISLTNRRHYLPWLLLTLSSIKESDRRTSIGHYISLPVSR* |
| Ga0105245_113765931 | 3300009098 | Miscanthus Rhizosphere | MIMRFRPANISLINRRHYLPRLPLTLSSKYNDKNNPSDLQILTGHTIS |
| Ga0105241_101587823 | 3300009174 | Corn Rhizosphere | MIMRFRPANISLINRRHYLPRLLLILSSNQKDDQRTLTGHYIS |
| Ga0116128_10067601 | 3300009518 | Peatland | RPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSGWATI* |
| Ga0116128_10799582 | 3300009518 | Peatland | RPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSE* |
| Ga0116108_10017101 | 3300009519 | Peatland | PANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSGWATI* |
| Ga0116108_10094521 | 3300009519 | Peatland | PANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSG* |
| Ga0116108_10708441 | 3300009519 | Peatland | PANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSGWSAIRPQRV* |
| Ga0116108_10827652 | 3300009519 | Peatland | PANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSE* |
| Ga0116107_11141222 | 3300009548 | Peatland | MIMRFRPANISLINRRLYLPRLLLTLPSIETDDQRILTGHY |
| Ga0105238_102695903 | 3300009551 | Corn Rhizosphere | MIMRFRPANISLINRRHYLPRLPLTLSSKYNDKNNPSDLQILTGHTISMS |
| Ga0116124_10700722 | 3300009634 | Peatland | LINRRLYLPRLLLTLPSIETDDQRILTGHYISMSE* |
| Ga0116121_10360422 | 3300009644 | Peatland | MIMRFRPANISLINRRLYLHRLLLTLSSVGKDDQRILTGHYIST |
| Ga0116132_10129773 | 3300009646 | Peatland | MRFRPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSE* |
| Ga0116131_10104401 | 3300009760 | Peatland | INRRLYLPRLLLTLPSIETDDQRILTGHYISMSG* |
| Ga0116219_100160894 | 3300009824 | Peatlands Soil | MRSRPANISLINRRHYLPRLPLTLSSFEKNDQLTLTGHYISLPD |
| Ga0116223_101333621 | 3300009839 | Peatlands Soil | ANISLINRRHYLPRLPLTLSSFEKNDQLTLTGHYISLPHWR* |
| Ga0126380_114880342 | 3300010043 | Tropical Forest Soil | MIMRFRPANISLINRRHYLPRLLLILSSFKENDQRTLTGHYISTSGWATTQTESTI* |
| Ga0074044_100274591 | 3300010343 | Bog Forest Soil | MIMRFRPANISLINRRHYLPRLLLTLSSKYNDKNNPSDLQILTGHTISTSG* |
| Ga0126369_108400271 | 3300012971 | Tropical Forest Soil | MRFRPANISLINRRHYLPRLLLTLSSIEKNDQPTLTGHYISMYV |
| Ga0164307_113100172 | 3300012987 | Soil | MIMRFRPANISLINRRHYLPRLLLTLPSNYNDKSNPSDSQTLT |
| Ga0164305_111176571 | 3300012989 | Soil | MIMRFRPANISLINRRHYLPRLLLTLPSNYNDKSNPSDSQTLTGS |
| Ga0181539_10055039 | 3300014151 | Bog | RPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSG* |
| Ga0181538_104847631 | 3300014162 | Bog | RRIMIMRFRPANISLINRRLYLHRLLLTLSSVGKNDQRILTGHYISMSG* |
| Ga0181528_109009822 | 3300014167 | Bog | ANISLINRRLYLPRLLLTLSSVGKDDQRILTGHYISTSALFKC* |
| Ga0181534_102397532 | 3300014168 | Bog | MIMRFRPANISLINRRHYLPRLLMTLSSKYNDKNNLSDSQILTGHTISTS |
| Ga0181535_100050361 | 3300014199 | Bog | IMRFRPANISLINRRHYLPRLLLTLSSKYNDKNNSSDLQILTGHTISTSG* |
| Ga0181535_101868601 | 3300014199 | Bog | MIMRFRPANISLINRRHYLPRLLMTLSSKYNDKNNLSDSQILTGHTISTSGW |
| Ga0182024_117552791 | 3300014501 | Permafrost | MIMRFRPANISLINRRHYLPRLLLTLSSKYNDKNNLSDSQILTGHTISI |
| Ga0137403_101072951 | 3300015264 | Vadose Zone Soil | MIMRFRPANISLINRRHYLPRLLLTLSSKDNDQKKTGDSQI |
| Ga0182037_101046041 | 3300016404 | Soil | MIMRFRPANISLINRRHYLPRLLLTLSSIEKDDQRILTGHYISRPYCR |
| Ga0182039_122213262 | 3300016422 | Soil | IMIMRFRPANISLINRRHYLPRLLLTLSSIKKTTSAP |
| Ga0187856_10063371 | 3300017925 | Peatland | PANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSGWSAIRPQRV |
| Ga0187856_10280351 | 3300017925 | Peatland | PANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSGWATI |
| Ga0187856_10644962 | 3300017925 | Peatland | MRFRPANISLINRRLYLPRLLLTLPSIETDDQRILTGHY |
| Ga0187856_11273822 | 3300017925 | Peatland | PANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSE |
| Ga0187877_11125832 | 3300017931 | Peatland | MRFRPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYIS |
| Ga0187877_13694322 | 3300017931 | Peatland | MRFRPANISLINRRLYLHRLLLTLSSVGKDDQRILTGHYIST |
| Ga0187848_103097111 | 3300017935 | Peatland | MRFRPANISLINRRLYLPRLLLTLPSIETDDQRILT |
| Ga0187854_100990661 | 3300017938 | Peatland | RPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSG |
| Ga0187853_101837902 | 3300017940 | Peatland | RPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSE |
| Ga0187879_102290021 | 3300017946 | Peatland | RPANISLINRRLYLHRLLLTLSSVGKDDQRILTGHYISMSG |
| Ga0187847_100140626 | 3300017948 | Peatland | MIMRFRPANISLINRRHYLPRLLLTLSSKYNDKNNPSDLQILTGHTISTSG |
| Ga0187868_10151281 | 3300018002 | Peatland | PANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSG |
| Ga0187865_10452272 | 3300018004 | Peatland | MRFRPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSG |
| Ga0187873_11315851 | 3300018013 | Peatland | ANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSE |
| Ga0187880_11467511 | 3300018016 | Peatland | MIVRFRPANISLINRRLYLPRLLLTLSSIEKDNQRILTGHYISISDTPSSLRCGVIG |
| Ga0187861_100182281 | 3300018020 | Peatland | FRPANISLINRRLYLHRLLLTLSSVGKDDQRILTGHYISTSG |
| Ga0187857_101031792 | 3300018026 | Peatland | MRFRPANISLINRRLYLHRLLLTLSSVGKDDQRILTGHYISTS |
| Ga0187857_102236971 | 3300018026 | Peatland | ISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSE |
| Ga0187863_100072239 | 3300018034 | Peatland | MIMRFRPANISLINRRHYLPRLLLTLSSKYNDKNNSSDLQILTGHTISTSG |
| Ga0187863_101080581 | 3300018034 | Peatland | RRIMIMRFRPANISLINRRHYLPRLLLTLYSFEEDDQRLLTGHSISISGLRVTRP |
| Ga0187851_102505342 | 3300018046 | Peatland | RFRPANISLINRRHYLPRLLLTLSSIEKGDQRTLTGHYISMSGLPVIQELDSEKSDRD |
| Ga0193727_11007742 | 3300019886 | Soil | MRFRPANISLINRRHYLPRLLLTLSSKYNDKNNHNDLQILTGHTISGKYQR |
| Ga0210401_100622785 | 3300020583 | Soil | MRFRPANISLINRRHYLPRLLLTLSSFEKNDQRTLTGHYISISP |
| Ga0210401_100797028 | 3300020583 | Soil | ISLINRRHYLPRLLLTLSSFEKNDQRILTGHYISLPGCR |
| Ga0210405_101584672 | 3300021171 | Soil | MIMRFRPANISLINRRHYLPRLLLTLSSKYNDKNNPNDLQILTGHTISGKYGR |
| Ga0210396_100719251 | 3300021180 | Soil | LINRRHYLPRLLLTLSSFEKNDQRILTGHYISLPGCR |
| Ga0210396_101895843 | 3300021180 | Soil | MIMRFRPANISLINRRHYLPRLLLTLSSFEKNDQRILTGHY |
| Ga0210396_106949921 | 3300021180 | Soil | MIMRFRPANISLINRRHYLPRLLLTLSSKYNDKNNPNDLQILTGHTISGERIFLKHA |
| Ga0210393_100147471 | 3300021401 | Soil | RPANISLINRRHYLPRLLLTLSSFEKNDQRILTGHYISLPGCR |
| Ga0210393_100688895 | 3300021401 | Soil | MRFRPANISLINRRLYLPRLRLILSSIEKDDLRLLTGHYISMSGLPFTRQE |
| Ga0210385_103310344 | 3300021402 | Soil | PANISLINRRHYLPRLLLTLSSFEKNDQRILTGHYISLPYCR |
| Ga0210397_101301203 | 3300021403 | Soil | MRFRPANISLINRRHYLPRLLLTLSSKYNDKNNPNDLQILTGHTISGEESAVIL |
| Ga0210397_101818673 | 3300021403 | Soil | RSRPANISLINRRLYLPRLRLILSSIEKDDLRLLTGHYISMSGLPFTRQE |
| Ga0210389_101223551 | 3300021404 | Soil | MRFRPANISLINRRHYLPRLLLTLSSFEKNDQRILTGHYISISESAVIRS |
| Ga0210389_105094081 | 3300021404 | Soil | RFRPANISSINRRHYLPRLLLTLSSFEKNDQRSLTGHYISLP |
| Ga0210387_104751172 | 3300021405 | Soil | MRFRPANISLINRRHYMPRLLLILSLKYKHKNHPTDLQLLTGHTISTSGSPKTRPKR |
| Ga0210386_102353351 | 3300021406 | Soil | MRFRPANISLINRRLYLPRLLLTLSSIEKDDQRILT |
| Ga0210383_100148047 | 3300021407 | Soil | MRFRPANISLINRRHYLPRLLLTLSPFEKNDQRILTGHYISLPTCRSSTQNRVEGGR |
| Ga0210383_101838181 | 3300021407 | Soil | MRFRPANISLINRRHYLPRLLLTLSSKYNDKNNPNDLQILTGHTISGEGWATIRH |
| Ga0210394_112944461 | 3300021420 | Soil | RFRPANISLINRRHYLPRLLLTLSSFEKNDQRILTGHYISLLYN |
| Ga0210384_102699732 | 3300021432 | Soil | MRFRPANISLINRRLYLPRLRLILSSIEKDDLRLLTGHYISMSVMPRQV |
| Ga0210391_101857542 | 3300021433 | Soil | MRFRPANISLINRRHYLPRLLLTLSSKYNDKNNPNDLQILTGHTISGDRIFL |
| Ga0210391_107837721 | 3300021433 | Soil | MRFRPANISLINRRHYLPRLLLTLSAFEKNDQRILTGHYISLPYCRLPTRNL |
| Ga0210390_100128661 | 3300021474 | Soil | LINRRHYLPRLLLTLSSFEKNDQRILTGHYISLPYC |
| Ga0210390_100618781 | 3300021474 | Soil | INRRHYLPRLLLTLSSFEKNDQRILTGHYISLPYCR |
| Ga0210392_100151165 | 3300021475 | Soil | MRFRPANISLINRRHYLPRLLLTLSSFEKNDQRILTGHYISLPNGR |
| Ga0210398_100124621 | 3300021477 | Soil | QPANISLINRRHYLPRLLLTLSSFEKNDQRILTGHYISLPGCR |
| Ga0210398_100759005 | 3300021477 | Soil | MRFRPANISLINRRHYLPRLLLTLSSKYNDKNNATDLQILTGHTISISG |
| Ga0210402_100378646 | 3300021478 | Soil | PANISLINRRHYLPRLLLTPSSFEKNDQRILTGHYISLPDRRRCARNPFI |
| Ga0236338_10194312 | 3300022593 | Freshwater | MRFRPANISLINRRLYLPRLLLTLSSIRKNDQRILTGHY |
| Ga0208194_10173672 | 3300025412 | Peatland | MRFRPANISLINRRLYLHRLLLTLSSVGKDDQRILTGHYISTSALF |
| Ga0208036_10244651 | 3300025419 | Peatland | MRFRPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSGAMPKMPATSPS |
| Ga0208034_10421562 | 3300025442 | Peatland | IMRFRPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSE |
| Ga0208038_10008051 | 3300025446 | Peatland | RFRPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSGWATI |
| Ga0208038_10212021 | 3300025446 | Peatland | MRFRPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMS |
| Ga0208038_10388632 | 3300025446 | Peatland | SLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSE |
| Ga0208190_10164354 | 3300025473 | Peatland | ANISLINRRLYLHRLLLTLSSVGKDDQRILTGHYISTSG |
| Ga0208192_10270002 | 3300025477 | Peatland | MRFRPANISLINRRLYLPRLLLTLPSIETDDQRIL |
| Ga0208688_10708661 | 3300025480 | Peatland | FRPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSGWATI |
| Ga0208686_10555942 | 3300025500 | Peatland | FRPANISLINRRLYLPRLLLTLPSIETDDQRILTGHYISMSE |
| Ga0207685_101372571 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MIMRFRPANISLINRRHYLPRLLLTLPSNYNDKSNPSDSQTLTGSH |
| Ga0207654_100175531 | 3300025911 | Corn Rhizosphere | MIMRFRPANISVINRRHYLPRLPLILSSNEKGDQRTLTGHYISTSGL |
| Ga0207783_10034431 | 3300026942 | Tropical Forest Soil | MIMRFRPANISLINRRHYLPRLLLILSSIEKNDQRTLTGHYISTSG |
| Ga0207777_10111243 | 3300027330 | Tropical Forest Soil | MRSRPANISLINRRHYLPRLPLTLSSIKENDQRTLTGHYIST |
| Ga0209418_10835331 | 3300027371 | Forest Soil | MRFRPANISLINRRLYLPRLLLILSSIEKDDQHILTGHYISMP |
| Ga0208199_10600101 | 3300027497 | Peatlands Soil | MRSRPANISLINRRHYLPRLPLTLSSFEKNDQLTLTGHYISLPG |
| Ga0209422_10211441 | 3300027629 | Forest Soil | MRFRPANISLINRRHYLPRLLLTLFSKYNDKNNPSDLQILTGHTISISGW |
| Ga0209772_100117013 | 3300027768 | Bog Forest Soil | MRFRPANISLINRRHYLPRLLLTLSSFEKNDQRTLTGHYISLP |
| Ga0209040_101109552 | 3300027824 | Bog Forest Soil | MRFRPANISLINRRHYLPRLLLTLSSFEKNDQRILTGHYIS |
| Ga0209517_101408092 | 3300027854 | Peatlands Soil | MRSRPANISLINRRHYLPRLPLTLSSFEKNDQLTLTGHYISL |
| Ga0209167_100960401 | 3300027867 | Surface Soil | MRFRPANISLINRRHYLPRLPLTLSSIETNGQRTLTGHYISGKH |
| Ga0265353_10016821 | 3300028015 | Soil | MRFRPANISLINRRHYLPRLLLTLSPFEKNDQRILTGHYIS |
| Ga0268266_104980402 | 3300028379 | Switchgrass Rhizosphere | MIMRFRPANISLINRRHYLPRLLLFLSSNYENKNNLNHAQALTGHTISTDQ |
| Ga0268264_100562115 | 3300028381 | Switchgrass Rhizosphere | MIMRFRPANISLINRRHYLPRLLLTLSLKYNDKNNPSDLQILTGHTISISV |
| Ga0308309_100899893 | 3300028906 | Soil | MIMRFRPANISLINRRHYLPRLLLTLSSKYNDKNNPNDLQILTGHTISGEE |
| Ga0308309_119129592 | 3300028906 | Soil | NISLTNRRHYLPWLLLTLSSIKESDRRTSIGHYISLPVSR |
| Ga0310037_104887861 | 3300030494 | Peatlands Soil | RRILIMRSRPANISLINRRHYLPRLPLTLSSFEKNDQLTLTGHYISLPHWR |
| Ga0316363_101335461 | 3300030659 | Peatlands Soil | ANISLINRRHYLPRLPLTLSSFEKNDQLTLTGHYISLPHWR |
| Ga0265770_10123021 | 3300030878 | Soil | MRFRPANISLINRRHYLPRLLLTLSSFEKNDQRILTGHYISLPDSRQAASS |
| Ga0265771_10146452 | 3300031010 | Soil | MRFRPANISLINRRHYLPRLLLTLSSFEKNDQRILTGHYISLPYCR |
| Ga0170824_1261260832 | 3300031231 | Forest Soil | MRLRPANISLINRRHYMPRLRLTLSLNYQNKNNLTHVKPLTGHTISTS |
| Ga0170824_1265747851 | 3300031231 | Forest Soil | MIMRFRPANISLINRRHYLPRLLLTLSSFEKNDQHTLT |
| Ga0170820_174215681 | 3300031446 | Forest Soil | MRSRPANISLINRRHYLPRLLLTLSSKYNDKNNPNDSQILTGHTISMSGL |
| Ga0170818_1066685251 | 3300031474 | Forest Soil | MIMRSRPANISLINRRHYLPRLLLTLSSKYNDKNNPNDSQILTGHTISMSG |
| Ga0310915_110062762 | 3300031573 | Soil | MRFRPANISLINRRHLLPRLLLTLSSIEENDQRTLTGHYISG |
| Ga0318574_100982392 | 3300031680 | Soil | MRFRPANISLINRRHLLPRLLLTLSSIEENDQRTLTGHYISGKSSR |
| Ga0310686_1159791995 | 3300031708 | Soil | ANISLINRRHYLPRLLLTLSSFEKNDQRTLTGHYISISG |
| Ga0307474_105018192 | 3300031718 | Hardwood Forest Soil | MRFRPANISLINRRLYLPRLLLTLSSIEKDDQRILTGHYISMSVLPTIRPQ |
| Ga0307474_109619301 | 3300031718 | Hardwood Forest Soil | MRFRPANIRLINRRHYLPRLLLPLYSFKRNDQRTL |
| Ga0318567_103761192 | 3300031821 | Soil | MRFRPANISLINRRHYMPRLPLTLSSIERNDQRTLTGHYISGKYRRPH |
| Ga0306921_112677451 | 3300031912 | Soil | MRFRPANISLINRRHYLPRLLLTLSSIEKDDQRTLTGHYISTS |
| Ga0318570_101634041 | 3300032054 | Soil | MRFRPANISLINRRHYPPRLPLTLSSIERNDQPTLTGHYI |
| Ga0318533_109384991 | 3300032059 | Soil | MRFRPANISLINRRHYLPRLLLTLSSIEKDDQRTLTGHYISASGLGVIRS |
| Ga0311301_105355681 | 3300032160 | Peatlands Soil | PANISLINRRHYLPRLPLTLSSFEKNDQLTLTGHYISLPHWR |
| Ga0306920_1026903831 | 3300032261 | Soil | MRFRPANISLINRRHYLPRLRLTLSSFKRNDQRTLTGHYISGKTVFHLVAVNTR |
| Ga0335075_101118665 | 3300032896 | Soil | MRFRPANISLINRRPYLPRLLLTLSSIKKYDQRILTGHYISTDGWPVNHQQL |
| Ga0326728_100120131 | 3300033402 | Peat Soil | MIMRFRPANISLINRRHYLPRLLLTLSSNEKDDQRILTGHYISISE |
| Ga0326727_100166481 | 3300033405 | Peat Soil | IMIMRFRPANISLINRRHYLPRLLLTLSSNEKDDQRILTGHYISISE |
| ⦗Top⦘ |