3300001147: Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O1

Overview

Basic Information

• IMG/M Taxon OID: 3300001147
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0071004 | Gp0054049 | Ga0000204
• Sample Name: Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O1
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 7955563
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Forest Soil Microbial Communities From Multiple Locations In Canada And Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): forest biome → solid layer → forest soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: El Dorado National Forest, Georgetown, California, USA
• Coordinates
  • Lat. (^o): 38.88
  • Long. (^o): -120.64
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091057	Metagenome / Metatranscriptome	108	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI11862J13335_100984	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	698

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI11862J13335_100984	JGI11862J13335_1009841	F091057	FAVRPDGADHQWRRVPPRELSIALVADERFGRVTDWIEAS*