| Basic Information | |
|---|---|
| Family ID | F091057 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VRPEGAYHQWRKDPSRELSIALVADERFGRATGWIEAS |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.48 % |
| % of genes near scaffold ends (potentially truncated) | 94.44 % |
| % of genes from short scaffolds (< 2000 bps) | 85.19 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.889 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.704 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.91% β-sheet: 0.00% Coil/Unstructured: 59.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 17.59 |
| PF08388 | GIIM | 16.67 |
| PF02371 | Transposase_20 | 3.70 |
| PF13340 | DUF4096 | 0.93 |
| PF06210 | DUF1003 | 0.93 |
| PF13561 | adh_short_C2 | 0.93 |
| PF00571 | CBS | 0.93 |
| PF03061 | 4HBT | 0.93 |
| PF13534 | Fer4_17 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 3.70 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001104|JGI11756J13266_100688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 634 | Open in IMG/M |
| 3300001147|JGI11862J13335_100984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 698 | Open in IMG/M |
| 3300001305|C688J14111_10053890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii | 1215 | Open in IMG/M |
| 3300001361|A30PFW6_1018174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1509 | Open in IMG/M |
| 3300001661|JGI12053J15887_10343135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 723 | Open in IMG/M |
| 3300001686|C688J18823_10105209 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300002231|KVRMV2_100655513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 696 | Open in IMG/M |
| 3300002568|C688J35102_120869940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1919 | Open in IMG/M |
| 3300003218|JGI26339J46600_10078710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 834 | Open in IMG/M |
| 3300003352|JGI26345J50200_1005892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1195 | Open in IMG/M |
| 3300003368|JGI26340J50214_10022280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1942 | Open in IMG/M |
| 3300004608|Ga0068924_1350782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1078 | Open in IMG/M |
| 3300005367|Ga0070667_100279555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1499 | Open in IMG/M |
| 3300005535|Ga0070684_101498750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 636 | Open in IMG/M |
| 3300005561|Ga0066699_10808749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 660 | Open in IMG/M |
| 3300005591|Ga0070761_10725454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 623 | Open in IMG/M |
| 3300005614|Ga0068856_101548120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 676 | Open in IMG/M |
| 3300005764|Ga0066903_106735395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii | 597 | Open in IMG/M |
| 3300006050|Ga0075028_100321159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 868 | Open in IMG/M |
| 3300006059|Ga0075017_101011345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 647 | Open in IMG/M |
| 3300006175|Ga0070712_100249873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1416 | Open in IMG/M |
| 3300006177|Ga0075362_10291742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 808 | Open in IMG/M |
| 3300006354|Ga0075021_11120603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 515 | Open in IMG/M |
| 3300006358|Ga0068871_100791494 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300006604|Ga0074060_11863051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 975 | Open in IMG/M |
| 3300006797|Ga0066659_10297064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1231 | Open in IMG/M |
| 3300006806|Ga0079220_10180885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 1197 | Open in IMG/M |
| 3300006893|Ga0073928_10308908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1185 | Open in IMG/M |
| 3300009176|Ga0105242_10772512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 948 | Open in IMG/M |
| 3300009787|Ga0116226_10111502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2833 | Open in IMG/M |
| 3300010042|Ga0126314_10997395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 621 | Open in IMG/M |
| 3300010044|Ga0126310_11222996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 604 | Open in IMG/M |
| 3300010110|Ga0126316_1046133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 739 | Open in IMG/M |
| 3300010339|Ga0074046_10913209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 509 | Open in IMG/M |
| 3300010361|Ga0126378_10166459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2259 | Open in IMG/M |
| 3300010362|Ga0126377_11411593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 769 | Open in IMG/M |
| 3300010364|Ga0134066_10421391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 514 | Open in IMG/M |
| 3300010375|Ga0105239_11188282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 879 | Open in IMG/M |
| 3300010397|Ga0134124_10327699 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300010857|Ga0126354_1076609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 551 | Open in IMG/M |
| 3300010859|Ga0126352_1304322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1156 | Open in IMG/M |
| 3300010862|Ga0126348_1324812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 672 | Open in IMG/M |
| 3300011047|Ga0138553_147738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 883 | Open in IMG/M |
| 3300011069|Ga0138592_1009519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 617 | Open in IMG/M |
| 3300012212|Ga0150985_104022449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 661 | Open in IMG/M |
| 3300012349|Ga0137387_10823829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 671 | Open in IMG/M |
| 3300012406|Ga0134053_1383451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 613 | Open in IMG/M |
| 3300012469|Ga0150984_102271352 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300012683|Ga0137398_11015382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 574 | Open in IMG/M |
| 3300012960|Ga0164301_10222748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1219 | Open in IMG/M |
| 3300012961|Ga0164302_10067726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1850 | Open in IMG/M |
| 3300012985|Ga0164308_10636258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 912 | Open in IMG/M |
| 3300013501|Ga0120154_1009335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2759 | Open in IMG/M |
| 3300013764|Ga0120111_1017078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2094 | Open in IMG/M |
| 3300013772|Ga0120158_10043779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3199 | Open in IMG/M |
| 3300014493|Ga0182016_10004751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 14902 | Open in IMG/M |
| 3300014655|Ga0181516_10162115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1133 | Open in IMG/M |
| 3300015195|Ga0167658_1011262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2745 | Open in IMG/M |
| 3300016730|Ga0181515_1075675 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300018890|Ga0193595_1132876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 693 | Open in IMG/M |
| 3300019787|Ga0182031_1150324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 649 | Open in IMG/M |
| 3300020579|Ga0210407_10004600 | All Organisms → cellular organisms → Bacteria | 10825 | Open in IMG/M |
| 3300021388|Ga0213875_10041836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2155 | Open in IMG/M |
| 3300021388|Ga0213875_10276708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 793 | Open in IMG/M |
| 3300021402|Ga0210385_10111990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1916 | Open in IMG/M |
| 3300021474|Ga0210390_10155733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1925 | Open in IMG/M |
| 3300021861|Ga0213853_10000225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 811 | Open in IMG/M |
| 3300022195|Ga0222625_1006350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 832 | Open in IMG/M |
| 3300022195|Ga0222625_1058508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 584 | Open in IMG/M |
| 3300022499|Ga0242641_1016684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 712 | Open in IMG/M |
| 3300022529|Ga0242668_1001707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2231 | Open in IMG/M |
| 3300022532|Ga0242655_10009976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1793 | Open in IMG/M |
| 3300022711|Ga0242674_1001275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1956 | Open in IMG/M |
| 3300022724|Ga0242665_10250783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 602 | Open in IMG/M |
| 3300025931|Ga0207644_10062345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2704 | Open in IMG/M |
| 3300025937|Ga0207669_10069285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2206 | Open in IMG/M |
| 3300025938|Ga0207704_10105497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1890 | Open in IMG/M |
| 3300026078|Ga0207702_11355423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 705 | Open in IMG/M |
| 3300026095|Ga0207676_11131667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 774 | Open in IMG/M |
| 3300026317|Ga0209154_1129415 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300027039|Ga0207855_1018194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 964 | Open in IMG/M |
| 3300027069|Ga0208859_1016868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 821 | Open in IMG/M |
| 3300027095|Ga0208606_101268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 984 | Open in IMG/M |
| 3300027729|Ga0209248_10021824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2003 | Open in IMG/M |
| 3300027737|Ga0209038_10159266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 684 | Open in IMG/M |
| 3300027765|Ga0209073_10216863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 733 | Open in IMG/M |
| 3300027768|Ga0209772_10006227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3165 | Open in IMG/M |
| 3300027860|Ga0209611_10480869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 700 | Open in IMG/M |
| 3300027911|Ga0209698_10105892 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
| 3300027915|Ga0209069_10042481 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
| 3300028824|Ga0307310_10511082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 606 | Open in IMG/M |
| 3300030524|Ga0311357_10433843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1234 | Open in IMG/M |
| 3300031039|Ga0102760_10788136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 556 | Open in IMG/M |
| 3300031236|Ga0302324_100985725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1147 | Open in IMG/M |
| 3300031259|Ga0302187_10081657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1896 | Open in IMG/M |
| 3300031546|Ga0318538_10738465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 534 | Open in IMG/M |
| 3300031663|Ga0307484_111177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 607 | Open in IMG/M |
| 3300031680|Ga0318574_10412491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 789 | Open in IMG/M |
| 3300031718|Ga0307474_11560587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 519 | Open in IMG/M |
| 3300031728|Ga0316578_10607376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 640 | Open in IMG/M |
| 3300031768|Ga0318509_10157369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1255 | Open in IMG/M |
| 3300031771|Ga0318546_10276891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1158 | Open in IMG/M |
| 3300031831|Ga0318564_10405232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 596 | Open in IMG/M |
| 3300032044|Ga0318558_10333674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 751 | Open in IMG/M |
| 3300032205|Ga0307472_100202617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1510 | Open in IMG/M |
| 3300032828|Ga0335080_11384136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 700 | Open in IMG/M |
| 3300033134|Ga0335073_10755054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1052 | Open in IMG/M |
| 3300033168|Ga0272423_1081786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1955 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.70% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.78% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.78% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.85% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.85% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 1.85% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.93% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.93% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.93% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.93% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001104 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 | Environmental | Open in IMG/M |
| 3300001147 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O1 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001361 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004608 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010110 | Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011047 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 34 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011069 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018890 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, bundles v1 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
| 3300027095 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF020 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031039 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031663 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Host-Associated | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033168 | Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand sud | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11756J13266_1006881 | 3300001104 | Forest Soil | FAVRPDGADHQWRRVPPXELSIALVADERFGRVTDWIEAS* |
| JGI11862J13335_1009841 | 3300001147 | Forest Soil | FAVRPDGADHQWRRVPPRELSIALVADERFGRVTDWIEAS* |
| C688J14111_100538901 | 3300001305 | Soil | PDGAFHQWRKVPPRELSIALVVDERFGWVTGWIEAS* |
| A30PFW6_10181742 | 3300001361 | Permafrost | FAVRPEGAFHQWREVPPRELSIALVADERFGRVTDWTEAS* |
| JGI12053J15887_103431352 | 3300001661 | Forest Soil | SLICFAFLIIAVRPDGADHQWRRVPPRELSIALVADERFGRVTDWIEAS* |
| C688J18823_101052091 | 3300001686 | Soil | SSQVLRFAVRPEGAFHQWREVPPGELSIALVADERFGWVTNRIEAS* |
| KVRMV2_1006555132 | 3300002231 | Marine Sediment | EGADHQWRKDPSRELSVDLVADERGGWVTGRFEAS* |
| C688J35102_1208699401 | 3300002568 | Soil | TVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS* |
| JGI26339J46600_100787101 | 3300003218 | Bog Forest Soil | QVLMVVVRPEGAFHQWREVPPRELSIALVADERFGRATGWIEAS* |
| JGI26345J50200_10058922 | 3300003352 | Bog Forest Soil | ELKNFAVRPDGAFHQWREVPPRELSIALVAGERFGRVTGWIEAS* |
| JGI26340J50214_100222803 | 3300003368 | Bog Forest Soil | LYVRPDGAHRQWRKVPRRELSIALVADERFCWATGGIEAS* |
| Ga0068924_13507821 | 3300004608 | Peatlands Soil | NVRPEGAHHQWRKVPHRELSIALVADERFCWATGGIEAS* |
| Ga0070667_1002795553 | 3300005367 | Switchgrass Rhizosphere | MVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS* |
| Ga0070684_1014987501 | 3300005535 | Corn Rhizosphere | SGTQASGFAVRPEGAYHQWRKDPSRELSITLVADERFGRATGRTEAS* |
| Ga0066699_108087492 | 3300005561 | Soil | GAYHQWRKDPSRELSIALVADERFGRVTGWIEAS* |
| Ga0070761_107254541 | 3300005591 | Soil | VRPDGAHHQWRKVPRRELSIALVADERFCRATGGIEAS* |
| Ga0068856_1015481201 | 3300005614 | Corn Rhizosphere | VRPEGAFHQWREDPPRELSIALVADERFGWVTDWIEAS* |
| Ga0066903_1067353951 | 3300005764 | Tropical Forest Soil | VRPDGAYHQWRRIPPRELSIGLVADERFGWATGRIEAS |
| Ga0075028_1003211593 | 3300006050 | Watersheds | LQCAPKGAFHQWRRVPPRELSIALVADERFGWATGPIEAS* |
| Ga0075017_1010113452 | 3300006059 | Watersheds | GAFHQWREDPPRELSIALVADERFGRATGWIEAS* |
| Ga0070712_1002498733 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FAVRPEGAFHQWREDPPRELSIALVADERFGWVTNRIEAS* |
| Ga0075362_102917421 | 3300006177 | Populus Endosphere | EIDMFMICSVRPDGVRHQWRKMPPRELSIDLVADERFDRVTGGIGAS* |
| Ga0075021_111206032 | 3300006354 | Watersheds | MHCCKAGFHTVCLIYAVRPDGAFHQWREDPPRELSIALVADERFGRVTGWIEAS* |
| Ga0068871_1007914942 | 3300006358 | Miscanthus Rhizosphere | EGAYHQWRKDPSRELSITLVADERFGRATGRTEAS* |
| Ga0074060_118630513 | 3300006604 | Soil | FVVRPDGAYHQWRKDPSRELSIALVADERFGRATGWIEAS* |
| Ga0066659_102970642 | 3300006797 | Soil | QAVFPKVLNYAVRPDGAYHQWRKDPSRELSIALVADERFGRATGWIEAS* |
| Ga0079220_101808854 | 3300006806 | Agricultural Soil | YFAVRPEGAFHQWREDPPGELSIALVADERFGWVTNWIEAS* |
| Ga0073928_103089082 | 3300006893 | Iron-Sulfur Acid Spring | TVRPDGAYYQWRKNPSRELSIDLVADERFGRAIGRTEAS* |
| Ga0105242_107725121 | 3300009176 | Miscanthus Rhizosphere | PTVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS* |
| Ga0116226_101115024 | 3300009787 | Host-Associated | AVRPDGADHQWRRVPPRELSIALVADERFGRVTGWTEAS* |
| Ga0126314_109973952 | 3300010042 | Serpentine Soil | LADRAAYPAIPSYSVRPDGVCHQWRKDPSRELSIDLVADERLGRVTGHVEAS* |
| Ga0126310_112229962 | 3300010044 | Serpentine Soil | RPEGAYHQWRKDPFRELSIALVADERFGRATGRIEAS* |
| Ga0126316_10461331 | 3300010110 | Soil | PDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS* |
| Ga0074046_109132092 | 3300010339 | Bog Forest Soil | SKDFAVRPDGAFHQWREVPPRELSVALVADERFGRATGWIEAS* |
| Ga0126378_101664592 | 3300010361 | Tropical Forest Soil | LICLGQEEFPKVLRFAVRPEGAFHQWREDPPRELSIALVADERFGWATGWIEAS* |
| Ga0126377_114115932 | 3300010362 | Tropical Forest Soil | TPDYAVRPDGAYHQWRRIPPRELSIGLVADERFGWATGRIEAS* |
| Ga0134066_104213911 | 3300010364 | Grasslands Soil | EVLNFVVRPEGAFHQWREDPPRELSIALVADERFGWVTNRIEAS* |
| Ga0105239_111882822 | 3300010375 | Corn Rhizosphere | IFLYYAVRPDGAFHQWKEVPPRELSIALVADERFGWVTNRIEAS* |
| Ga0134124_103276993 | 3300010397 | Terrestrial Soil | VRPEGAFHQWREDPPRELSIALVADERFGWVTNWIEAS* |
| Ga0126354_10766091 | 3300010857 | Boreal Forest Soil | PEGAFHQWREVPPRELSIALVADERFGWVTGWIEAS* |
| Ga0126352_13043222 | 3300010859 | Boreal Forest Soil | DGAYYQWKKDPPRELSIDLVADERFGRAIGRIEAS* |
| Ga0126348_13248121 | 3300010862 | Boreal Forest Soil | PDGADHQWREVPPRELSIALVADERFGWATGWIEAS* |
| Ga0138553_1477381 | 3300011047 | Peatlands Soil | DGAHRQWRKVPRRELSIALVADERFCWATGGIEAS* |
| Ga0138592_10095191 | 3300011069 | Peatlands Soil | PEGAHHQWRKVPHRELSIALVADERFCWATGGIEAS* |
| Ga0150985_1040224491 | 3300012212 | Avena Fatua Rhizosphere | AVRPEGADHQWRRIPPRELSIAVVADERLGRVIDWAEAS* |
| Ga0137387_108238292 | 3300012349 | Vadose Zone Soil | EAIFQRQREFKISAVRPDGAYHQWRKDPSRELSIALVADERFGRATGWIEAS* |
| Ga0134053_13834511 | 3300012406 | Grasslands Soil | VGRRLGRRVLTFAVRPDGAFHQWREDPPRELSIALVADERFGWVTGWIEAS* |
| Ga0150984_1022713522 | 3300012469 | Avena Fatua Rhizosphere | AVRPEGAFHQWREVPPGELSIALVADERFGWVTNRIEAS* |
| Ga0137398_110153822 | 3300012683 | Vadose Zone Soil | RPDGAYHQWRKIPPRELLIDLVADERFVWATERAEAS* |
| Ga0164301_102227481 | 3300012960 | Soil | VRPEGAFHQWREDPPRELSIALVADERFGWVTNRIEAS* |
| Ga0164302_100677261 | 3300012961 | Soil | SPLVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS* |
| Ga0164308_106362582 | 3300012985 | Soil | VRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS* |
| Ga0120154_10093351 | 3300013501 | Permafrost | GAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS* |
| Ga0120111_10170783 | 3300013764 | Permafrost | PMVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS* |
| Ga0120158_100437793 | 3300013772 | Permafrost | VLPKFLNSVVRPEGAFHQWREVPPRELSIALVADERFGRVTDWTEAS* |
| Ga0182016_1000475116 | 3300014493 | Bog | VVRPDGACIQWREDPPGELSIALVADERFGRATGWIE |
| Ga0181516_101621151 | 3300014655 | Bog | GFQCAPMARFHQWRRDPPRELSIDLVADERFGWVTGWIEAS* |
| Ga0167658_10112621 | 3300015195 | Glacier Forefield Soil | SNRMVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS* |
| Ga0181515_10756752 | 3300016730 | Peatland | RPDGAHHQWRKVPPRELSIDLVADERFCWVTGGIEAS |
| Ga0193595_11328762 | 3300018890 | Soil | ILNYAVRPEGADHQWRRVPPRELSIALVADERFGRVTGWIEAS |
| Ga0182031_11503241 | 3300019787 | Bog | PDGACIQWWREDPPGELSIALVADERFGRATGWIEAS |
| Ga0210407_1000460019 | 3300020579 | Soil | MYAVAVKFLIFVVRPDGAYHQWRKDPSRELSIALVADERFGRATGGIEAS |
| Ga0213875_100418361 | 3300021388 | Plant Roots | VPGKGVYHQWRKVPPRKMSISLVADERFGWATGRIEA |
| Ga0213875_102767081 | 3300021388 | Plant Roots | HTVCKNFAVRPDGAFHQWREDPPRELSIALVADERFGRATGWIEAS |
| Ga0210385_101119901 | 3300021402 | Soil | RFAVRPDGAFHQWREVPPRELSIALVADERFGRATDWIEAS |
| Ga0210390_101557331 | 3300021474 | Soil | VHPIKIYAVRPDGAYHQWRKDPSRELSIALVADERFGRVTGWIEAS |
| Ga0213853_100002251 | 3300021861 | Watersheds | PDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS |
| Ga0222625_10063501 | 3300022195 | Groundwater Sediment | DWIGDFQNPDFPVRPDGAYHQWRRVPPGELSIAPVADERFGRATDWAGAS |
| Ga0222625_10585081 | 3300022195 | Groundwater Sediment | PDGAYYQWRKDPPRELSIDLVADERFGRAIGRTEAS |
| Ga0242641_10166842 | 3300022499 | Soil | PDGAYHQWRKDPSRELSIALVADERFGRVTGWIEAS |
| Ga0242668_10017071 | 3300022529 | Soil | LIGLGQGNFPKVLNFAVRPDGAYHQWRKDPSRELSIALVADERFGRVTGWIEAS |
| Ga0242655_100099761 | 3300022532 | Soil | DGAYHQWRKDLSRELSIALVADERFGRATGWFEAS |
| Ga0242674_10012751 | 3300022711 | Soil | LGQGNFPKVLNFAVRPDGAYHQWRKDPSRELSIALVADERFGRVTGWIEAS |
| Ga0242665_102507832 | 3300022724 | Soil | FAARPDGAYHQWRKDPSRELSIALVADERFVRVTGWIEAS |
| Ga0207644_100623451 | 3300025931 | Switchgrass Rhizosphere | TSNHMVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS |
| Ga0207669_100692851 | 3300025937 | Miscanthus Rhizosphere | SLTVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS |
| Ga0207704_101054971 | 3300025938 | Miscanthus Rhizosphere | SAIPVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS |
| Ga0207702_113554231 | 3300026078 | Corn Rhizosphere | CPNVSKTSVFAVRPEGAFHQWREVPPRELSIALVADERFGWVTDWIEAS |
| Ga0207676_111316671 | 3300026095 | Switchgrass Rhizosphere | DGAVYQWRKVPPRELSIALVADERPGRATGLVEAS |
| Ga0209154_11294151 | 3300026317 | Soil | QEYVPACFANGAVRPEGADHQWRRIPLGELSIDPVVDERLGRVTERAGAS |
| Ga0207855_10181942 | 3300027039 | Tropical Forest Soil | FLTFAVRPEGAFHQWREDPPRELSIALVADERFGWATGWIEAS |
| Ga0208859_10168683 | 3300027069 | Forest Soil | FAVRPDGAYHQWWKAPSRELSIALVADERFGWVTGWIEAS |
| Ga0208606_1012683 | 3300027095 | Forest Soil | MYAVAVKFLIFVVRPDGAYHQWRKDPSRELSIALVADERFGRATGWIEAS |
| Ga0209248_100218242 | 3300027729 | Bog Forest Soil | VRPEGAYHQWRKDPSRELSIALVADERFGRATGWIEAS |
| Ga0209038_101592662 | 3300027737 | Bog Forest Soil | LNFAVRPEGAYHQWRKDPSRELSIALVADERFGRATG |
| Ga0209073_102168632 | 3300027765 | Agricultural Soil | FLIYAVRPEGAFHQWREVPPRELSIALVADERFGWVTDWIEAS |
| Ga0209772_100062273 | 3300027768 | Bog Forest Soil | MVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS |
| Ga0209611_104808692 | 3300027860 | Host-Associated | LNFAVRPEGAFHQWREVPPRELSVALVADERFGRVTGRAEAS |
| Ga0209698_101058924 | 3300027911 | Watersheds | RSYLPGSPEVLISAVRPEGAFHQWREDPPRELSIALVADERFGWVTGRIGAS |
| Ga0209069_100424813 | 3300027915 | Watersheds | FLSFAVRPEGACRQWREDPPRELSIALVADERFGRVTGRIEAS |
| Ga0307310_105110822 | 3300028824 | Soil | PDGAYHQWRKIPPRELLIDLVADERFVWATERAEAS |
| Ga0311357_104338432 | 3300030524 | Palsa | TVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS |
| Ga0102760_107881361 | 3300031039 | Soil | VQKIFIYAVRPEGAYRQWRKDPSRELSIALVADERFGRATGRIEAS |
| Ga0302324_1009857251 | 3300031236 | Palsa | PVMAVRPEGAKHQWRRVPPRELSIDLVADERFGRVTGRAGAS |
| Ga0302187_100816571 | 3300031259 | Bog | KNYAVRPEGAFHQWRRVPPRELSIALVADERFGRATGGTEAS |
| Ga0318538_107384652 | 3300031546 | Soil | VAPEGLVFLIFAVRPEGAFHQWREDPPRELSIALVADERFGWATGWIEAS |
| Ga0307484_1111771 | 3300031663 | Hardwood Forest Soil | DGAYHQWRKDPSRELSIALVADERFGRVTGWIEAS |
| Ga0318574_104124912 | 3300031680 | Soil | ILTCVVRPEGAFPQWRKDPSRELSIALVADERFGRVTGWTGAS |
| Ga0307474_115605871 | 3300031718 | Hardwood Forest Soil | FHAPPILFFAVRPEGAFHQWREDPPRELSIALVADERFGWVTNRIEAS |
| Ga0316578_106073762 | 3300031728 | Rhizosphere | FFSPDYAVRPEGAYHQWRKIPPRELSIDLVADERFGWATGRVEAS |
| Ga0318509_101573691 | 3300031768 | Soil | RQHELHSRSTKILISAVRPEGAYHQWRKDPSRELSMALVADDRFSRVTGWIEAS |
| Ga0318546_102768911 | 3300031771 | Soil | AEVKIYAVRPEGAFHQWRKDPSRELSIALVADERFGRVTGWTGAS |
| Ga0318564_104052321 | 3300031831 | Soil | YVDAHPWRKIPPRELSIDLVADERFGRAIERTEAS |
| Ga0318558_103336741 | 3300032044 | Soil | AIFLTFAVRPEGAFHQWREDPPRELSIALVADERFGWATGWIEAS |
| Ga0307472_1002026172 | 3300032205 | Hardwood Forest Soil | MYIRTVRLDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS |
| Ga0335080_113841361 | 3300032828 | Soil | HSRASRFVKILEFAVRPEGADHQWREVPPRELSIALVADERFGWVTGWIEAS |
| Ga0335073_107550541 | 3300033134 | Soil | SIVPEIKIFAVRPEGADHQWREVPPRELSIALVADERFGRLTGWIEAS |
| Ga0272423_10817862 | 3300033168 | Rock | NSAVRPEGADHQWRRVPPRELSIALVADERFGRVTDWIEAS |
| ⦗Top⦘ |