NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091057

Metagenome / Metatranscriptome Family F091057

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091057
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 42 residues
Representative Sequence VRPEGAYHQWRKDPSRELSIALVADERFGRATGWIEAS
Number of Associated Samples 106
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.48 %
% of genes near scaffold ends (potentially truncated) 94.44 %
% of genes from short scaffolds (< 2000 bps) 85.19 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.889 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.704 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.91%    β-sheet: 0.00%    Coil/Unstructured: 59.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF00078RVT_1 17.59
PF08388GIIM 16.67
PF02371Transposase_20 3.70
PF13340DUF4096 0.93
PF06210DUF1003 0.93
PF13561adh_short_C2 0.93
PF00571CBS 0.93
PF030614HBT 0.93
PF13534Fer4_17 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 3.70
COG4420Uncharacterized membrane proteinFunction unknown [S] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001104|JGI11756J13266_100688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei634Open in IMG/M
3300001147|JGI11862J13335_100984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium698Open in IMG/M
3300001305|C688J14111_10053890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii1215Open in IMG/M
3300001361|A30PFW6_1018174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1509Open in IMG/M
3300001661|JGI12053J15887_10343135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium723Open in IMG/M
3300001686|C688J18823_10105209All Organisms → cellular organisms → Bacteria1960Open in IMG/M
3300002231|KVRMV2_100655513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales696Open in IMG/M
3300002568|C688J35102_120869940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1919Open in IMG/M
3300003218|JGI26339J46600_10078710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium834Open in IMG/M
3300003352|JGI26345J50200_1005892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1195Open in IMG/M
3300003368|JGI26340J50214_10022280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1942Open in IMG/M
3300004608|Ga0068924_1350782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1078Open in IMG/M
3300005367|Ga0070667_100279555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1499Open in IMG/M
3300005535|Ga0070684_101498750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium636Open in IMG/M
3300005561|Ga0066699_10808749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1660Open in IMG/M
3300005591|Ga0070761_10725454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium623Open in IMG/M
3300005614|Ga0068856_101548120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei676Open in IMG/M
3300005764|Ga0066903_106735395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii597Open in IMG/M
3300006050|Ga0075028_100321159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1868Open in IMG/M
3300006059|Ga0075017_101011345All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis647Open in IMG/M
3300006175|Ga0070712_100249873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1416Open in IMG/M
3300006177|Ga0075362_10291742All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum808Open in IMG/M
3300006354|Ga0075021_11120603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium515Open in IMG/M
3300006358|Ga0068871_100791494All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300006604|Ga0074060_11863051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium975Open in IMG/M
3300006797|Ga0066659_10297064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1231Open in IMG/M
3300006806|Ga0079220_10180885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.11197Open in IMG/M
3300006893|Ga0073928_10308908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1185Open in IMG/M
3300009176|Ga0105242_10772512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium948Open in IMG/M
3300009787|Ga0116226_10111502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2833Open in IMG/M
3300010042|Ga0126314_10997395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1621Open in IMG/M
3300010044|Ga0126310_11222996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1604Open in IMG/M
3300010110|Ga0126316_1046133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum739Open in IMG/M
3300010339|Ga0074046_10913209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1509Open in IMG/M
3300010361|Ga0126378_10166459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2259Open in IMG/M
3300010362|Ga0126377_11411593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium769Open in IMG/M
3300010364|Ga0134066_10421391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei514Open in IMG/M
3300010375|Ga0105239_11188282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales879Open in IMG/M
3300010397|Ga0134124_10327699All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300010857|Ga0126354_1076609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1551Open in IMG/M
3300010859|Ga0126352_1304322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1156Open in IMG/M
3300010862|Ga0126348_1324812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei672Open in IMG/M
3300011047|Ga0138553_147738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium883Open in IMG/M
3300011069|Ga0138592_1009519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1617Open in IMG/M
3300012212|Ga0150985_104022449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661661Open in IMG/M
3300012349|Ga0137387_10823829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium671Open in IMG/M
3300012406|Ga0134053_1383451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661613Open in IMG/M
3300012469|Ga0150984_102271352All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300012683|Ga0137398_11015382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei574Open in IMG/M
3300012960|Ga0164301_10222748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1219Open in IMG/M
3300012961|Ga0164302_10067726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1850Open in IMG/M
3300012985|Ga0164308_10636258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium912Open in IMG/M
3300013501|Ga0120154_1009335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2759Open in IMG/M
3300013764|Ga0120111_1017078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2094Open in IMG/M
3300013772|Ga0120158_10043779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3199Open in IMG/M
3300014493|Ga0182016_10004751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae14902Open in IMG/M
3300014655|Ga0181516_10162115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1133Open in IMG/M
3300015195|Ga0167658_1011262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2745Open in IMG/M
3300016730|Ga0181515_1075675All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300018890|Ga0193595_1132876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei693Open in IMG/M
3300019787|Ga0182031_1150324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei649Open in IMG/M
3300020579|Ga0210407_10004600All Organisms → cellular organisms → Bacteria10825Open in IMG/M
3300021388|Ga0213875_10041836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2155Open in IMG/M
3300021388|Ga0213875_10276708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium793Open in IMG/M
3300021402|Ga0210385_10111990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1916Open in IMG/M
3300021474|Ga0210390_10155733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1925Open in IMG/M
3300021861|Ga0213853_10000225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum811Open in IMG/M
3300022195|Ga0222625_1006350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium832Open in IMG/M
3300022195|Ga0222625_1058508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1584Open in IMG/M
3300022499|Ga0242641_1016684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium712Open in IMG/M
3300022529|Ga0242668_1001707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2231Open in IMG/M
3300022532|Ga0242655_10009976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1793Open in IMG/M
3300022711|Ga0242674_1001275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1956Open in IMG/M
3300022724|Ga0242665_10250783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei602Open in IMG/M
3300025931|Ga0207644_10062345All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2704Open in IMG/M
3300025937|Ga0207669_10069285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2206Open in IMG/M
3300025938|Ga0207704_10105497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1890Open in IMG/M
3300026078|Ga0207702_11355423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei705Open in IMG/M
3300026095|Ga0207676_11131667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei774Open in IMG/M
3300026317|Ga0209154_1129415All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300027039|Ga0207855_1018194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium964Open in IMG/M
3300027069|Ga0208859_1016868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales821Open in IMG/M
3300027095|Ga0208606_101268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales984Open in IMG/M
3300027729|Ga0209248_10021824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2003Open in IMG/M
3300027737|Ga0209038_10159266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales684Open in IMG/M
3300027765|Ga0209073_10216863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei733Open in IMG/M
3300027768|Ga0209772_10006227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3165Open in IMG/M
3300027860|Ga0209611_10480869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei700Open in IMG/M
3300027911|Ga0209698_10105892All Organisms → cellular organisms → Bacteria2349Open in IMG/M
3300027915|Ga0209069_10042481All Organisms → cellular organisms → Bacteria2131Open in IMG/M
3300028824|Ga0307310_10511082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1606Open in IMG/M
3300030524|Ga0311357_10433843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1234Open in IMG/M
3300031039|Ga0102760_10788136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1556Open in IMG/M
3300031236|Ga0302324_100985725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1147Open in IMG/M
3300031259|Ga0302187_10081657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1896Open in IMG/M
3300031546|Ga0318538_10738465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei534Open in IMG/M
3300031663|Ga0307484_111177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium607Open in IMG/M
3300031680|Ga0318574_10412491All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales789Open in IMG/M
3300031718|Ga0307474_11560587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei519Open in IMG/M
3300031728|Ga0316578_10607376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium640Open in IMG/M
3300031768|Ga0318509_10157369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1255Open in IMG/M
3300031771|Ga0318546_10276891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1158Open in IMG/M
3300031831|Ga0318564_10405232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium596Open in IMG/M
3300032044|Ga0318558_10333674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium751Open in IMG/M
3300032205|Ga0307472_100202617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1510Open in IMG/M
3300032828|Ga0335080_11384136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1700Open in IMG/M
3300033134|Ga0335073_10755054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1052Open in IMG/M
3300033168|Ga0272423_1081786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1955Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.89%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil5.56%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.63%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.70%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.70%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.78%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.78%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.85%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.85%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.85%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.85%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.85%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated1.85%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.93%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.93%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.93%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.93%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.93%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.93%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.93%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.93%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001104Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3EnvironmentalOpen in IMG/M
3300001147Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O1EnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001361Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300003352Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1EnvironmentalOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300004608Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009787Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010110Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010857Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010862Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011047Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 34 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011069Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012406Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300015195Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300016730Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018890Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, bundles v1EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022499Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022711Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300027039Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes)EnvironmentalOpen in IMG/M
3300027069Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes)EnvironmentalOpen in IMG/M
3300027095Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF020 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027860Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300031039Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031663Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031728Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrCHost-AssociatedOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033168Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand sudEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11756J13266_10068813300001104Forest SoilFAVRPDGADHQWRRVPPXELSIALVADERFGRVTDWIEAS*
JGI11862J13335_10098413300001147Forest SoilFAVRPDGADHQWRRVPPRELSIALVADERFGRVTDWIEAS*
C688J14111_1005389013300001305SoilPDGAFHQWRKVPPRELSIALVVDERFGWVTGWIEAS*
A30PFW6_101817423300001361PermafrostFAVRPEGAFHQWREVPPRELSIALVADERFGRVTDWTEAS*
JGI12053J15887_1034313523300001661Forest SoilSLICFAFLIIAVRPDGADHQWRRVPPRELSIALVADERFGRVTDWIEAS*
C688J18823_1010520913300001686SoilSSQVLRFAVRPEGAFHQWREVPPGELSIALVADERFGWVTNRIEAS*
KVRMV2_10065551323300002231Marine SedimentEGADHQWRKDPSRELSVDLVADERGGWVTGRFEAS*
C688J35102_12086994013300002568SoilTVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS*
JGI26339J46600_1007871013300003218Bog Forest SoilQVLMVVVRPEGAFHQWREVPPRELSIALVADERFGRATGWIEAS*
JGI26345J50200_100589223300003352Bog Forest SoilELKNFAVRPDGAFHQWREVPPRELSIALVAGERFGRVTGWIEAS*
JGI26340J50214_1002228033300003368Bog Forest SoilLYVRPDGAHRQWRKVPRRELSIALVADERFCWATGGIEAS*
Ga0068924_135078213300004608Peatlands SoilNVRPEGAHHQWRKVPHRELSIALVADERFCWATGGIEAS*
Ga0070667_10027955533300005367Switchgrass RhizosphereMVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS*
Ga0070684_10149875013300005535Corn RhizosphereSGTQASGFAVRPEGAYHQWRKDPSRELSITLVADERFGRATGRTEAS*
Ga0066699_1080874923300005561SoilGAYHQWRKDPSRELSIALVADERFGRVTGWIEAS*
Ga0070761_1072545413300005591SoilVRPDGAHHQWRKVPRRELSIALVADERFCRATGGIEAS*
Ga0068856_10154812013300005614Corn RhizosphereVRPEGAFHQWREDPPRELSIALVADERFGWVTDWIEAS*
Ga0066903_10673539513300005764Tropical Forest SoilVRPDGAYHQWRRIPPRELSIGLVADERFGWATGRIEAS
Ga0075028_10032115933300006050WatershedsLQCAPKGAFHQWRRVPPRELSIALVADERFGWATGPIEAS*
Ga0075017_10101134523300006059WatershedsGAFHQWREDPPRELSIALVADERFGRATGWIEAS*
Ga0070712_10024987333300006175Corn, Switchgrass And Miscanthus RhizosphereFAVRPEGAFHQWREDPPRELSIALVADERFGWVTNRIEAS*
Ga0075362_1029174213300006177Populus EndosphereEIDMFMICSVRPDGVRHQWRKMPPRELSIDLVADERFDRVTGGIGAS*
Ga0075021_1112060323300006354WatershedsMHCCKAGFHTVCLIYAVRPDGAFHQWREDPPRELSIALVADERFGRVTGWIEAS*
Ga0068871_10079149423300006358Miscanthus RhizosphereEGAYHQWRKDPSRELSITLVADERFGRATGRTEAS*
Ga0074060_1186305133300006604SoilFVVRPDGAYHQWRKDPSRELSIALVADERFGRATGWIEAS*
Ga0066659_1029706423300006797SoilQAVFPKVLNYAVRPDGAYHQWRKDPSRELSIALVADERFGRATGWIEAS*
Ga0079220_1018088543300006806Agricultural SoilYFAVRPEGAFHQWREDPPGELSIALVADERFGWVTNWIEAS*
Ga0073928_1030890823300006893Iron-Sulfur Acid SpringTVRPDGAYYQWRKNPSRELSIDLVADERFGRAIGRTEAS*
Ga0105242_1077251213300009176Miscanthus RhizospherePTVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS*
Ga0116226_1011150243300009787Host-AssociatedAVRPDGADHQWRRVPPRELSIALVADERFGRVTGWTEAS*
Ga0126314_1099739523300010042Serpentine SoilLADRAAYPAIPSYSVRPDGVCHQWRKDPSRELSIDLVADERLGRVTGHVEAS*
Ga0126310_1122299623300010044Serpentine SoilRPEGAYHQWRKDPFRELSIALVADERFGRATGRIEAS*
Ga0126316_104613313300010110SoilPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS*
Ga0074046_1091320923300010339Bog Forest SoilSKDFAVRPDGAFHQWREVPPRELSVALVADERFGRATGWIEAS*
Ga0126378_1016645923300010361Tropical Forest SoilLICLGQEEFPKVLRFAVRPEGAFHQWREDPPRELSIALVADERFGWATGWIEAS*
Ga0126377_1141159323300010362Tropical Forest SoilTPDYAVRPDGAYHQWRRIPPRELSIGLVADERFGWATGRIEAS*
Ga0134066_1042139113300010364Grasslands SoilEVLNFVVRPEGAFHQWREDPPRELSIALVADERFGWVTNRIEAS*
Ga0105239_1118828223300010375Corn RhizosphereIFLYYAVRPDGAFHQWKEVPPRELSIALVADERFGWVTNRIEAS*
Ga0134124_1032769933300010397Terrestrial SoilVRPEGAFHQWREDPPRELSIALVADERFGWVTNWIEAS*
Ga0126354_107660913300010857Boreal Forest SoilPEGAFHQWREVPPRELSIALVADERFGWVTGWIEAS*
Ga0126352_130432223300010859Boreal Forest SoilDGAYYQWKKDPPRELSIDLVADERFGRAIGRIEAS*
Ga0126348_132481213300010862Boreal Forest SoilPDGADHQWREVPPRELSIALVADERFGWATGWIEAS*
Ga0138553_14773813300011047Peatlands SoilDGAHRQWRKVPRRELSIALVADERFCWATGGIEAS*
Ga0138592_100951913300011069Peatlands SoilPEGAHHQWRKVPHRELSIALVADERFCWATGGIEAS*
Ga0150985_10402244913300012212Avena Fatua RhizosphereAVRPEGADHQWRRIPPRELSIAVVADERLGRVIDWAEAS*
Ga0137387_1082382923300012349Vadose Zone SoilEAIFQRQREFKISAVRPDGAYHQWRKDPSRELSIALVADERFGRATGWIEAS*
Ga0134053_138345113300012406Grasslands SoilVGRRLGRRVLTFAVRPDGAFHQWREDPPRELSIALVADERFGWVTGWIEAS*
Ga0150984_10227135223300012469Avena Fatua RhizosphereAVRPEGAFHQWREVPPGELSIALVADERFGWVTNRIEAS*
Ga0137398_1101538223300012683Vadose Zone SoilRPDGAYHQWRKIPPRELLIDLVADERFVWATERAEAS*
Ga0164301_1022274813300012960SoilVRPEGAFHQWREDPPRELSIALVADERFGWVTNRIEAS*
Ga0164302_1006772613300012961SoilSPLVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS*
Ga0164308_1063625823300012985SoilVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS*
Ga0120154_100933513300013501PermafrostGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS*
Ga0120111_101707833300013764PermafrostPMVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS*
Ga0120158_1004377933300013772PermafrostVLPKFLNSVVRPEGAFHQWREVPPRELSIALVADERFGRVTDWTEAS*
Ga0182016_10004751163300014493BogVVRPDGACIQWREDPPGELSIALVADERFGRATGWIE
Ga0181516_1016211513300014655BogGFQCAPMARFHQWRRDPPRELSIDLVADERFGWVTGWIEAS*
Ga0167658_101126213300015195Glacier Forefield SoilSNRMVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS*
Ga0181515_107567523300016730PeatlandRPDGAHHQWRKVPPRELSIDLVADERFCWVTGGIEAS
Ga0193595_113287623300018890SoilILNYAVRPEGADHQWRRVPPRELSIALVADERFGRVTGWIEAS
Ga0182031_115032413300019787BogPDGACIQWWREDPPGELSIALVADERFGRATGWIEAS
Ga0210407_10004600193300020579SoilMYAVAVKFLIFVVRPDGAYHQWRKDPSRELSIALVADERFGRATGGIEAS
Ga0213875_1004183613300021388Plant RootsVPGKGVYHQWRKVPPRKMSISLVADERFGWATGRIEA
Ga0213875_1027670813300021388Plant RootsHTVCKNFAVRPDGAFHQWREDPPRELSIALVADERFGRATGWIEAS
Ga0210385_1011199013300021402SoilRFAVRPDGAFHQWREVPPRELSIALVADERFGRATDWIEAS
Ga0210390_1015573313300021474SoilVHPIKIYAVRPDGAYHQWRKDPSRELSIALVADERFGRVTGWIEAS
Ga0213853_1000022513300021861WatershedsPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS
Ga0222625_100635013300022195Groundwater SedimentDWIGDFQNPDFPVRPDGAYHQWRRVPPGELSIAPVADERFGRATDWAGAS
Ga0222625_105850813300022195Groundwater SedimentPDGAYYQWRKDPPRELSIDLVADERFGRAIGRTEAS
Ga0242641_101668423300022499SoilPDGAYHQWRKDPSRELSIALVADERFGRVTGWIEAS
Ga0242668_100170713300022529SoilLIGLGQGNFPKVLNFAVRPDGAYHQWRKDPSRELSIALVADERFGRVTGWIEAS
Ga0242655_1000997613300022532SoilDGAYHQWRKDLSRELSIALVADERFGRATGWFEAS
Ga0242674_100127513300022711SoilLGQGNFPKVLNFAVRPDGAYHQWRKDPSRELSIALVADERFGRVTGWIEAS
Ga0242665_1025078323300022724SoilFAARPDGAYHQWRKDPSRELSIALVADERFVRVTGWIEAS
Ga0207644_1006234513300025931Switchgrass RhizosphereTSNHMVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS
Ga0207669_1006928513300025937Miscanthus RhizosphereSLTVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS
Ga0207704_1010549713300025938Miscanthus RhizosphereSAIPVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS
Ga0207702_1135542313300026078Corn RhizosphereCPNVSKTSVFAVRPEGAFHQWREVPPRELSIALVADERFGWVTDWIEAS
Ga0207676_1113166713300026095Switchgrass RhizosphereDGAVYQWRKVPPRELSIALVADERPGRATGLVEAS
Ga0209154_112941513300026317SoilQEYVPACFANGAVRPEGADHQWRRIPLGELSIDPVVDERLGRVTERAGAS
Ga0207855_101819423300027039Tropical Forest SoilFLTFAVRPEGAFHQWREDPPRELSIALVADERFGWATGWIEAS
Ga0208859_101686833300027069Forest SoilFAVRPDGAYHQWWKAPSRELSIALVADERFGWVTGWIEAS
Ga0208606_10126833300027095Forest SoilMYAVAVKFLIFVVRPDGAYHQWRKDPSRELSIALVADERFGRATGWIEAS
Ga0209248_1002182423300027729Bog Forest SoilVRPEGAYHQWRKDPSRELSIALVADERFGRATGWIEAS
Ga0209038_1015926623300027737Bog Forest SoilLNFAVRPEGAYHQWRKDPSRELSIALVADERFGRATG
Ga0209073_1021686323300027765Agricultural SoilFLIYAVRPEGAFHQWREVPPRELSIALVADERFGWVTDWIEAS
Ga0209772_1000622733300027768Bog Forest SoilMVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS
Ga0209611_1048086923300027860Host-AssociatedLNFAVRPEGAFHQWREVPPRELSVALVADERFGRVTGRAEAS
Ga0209698_1010589243300027911WatershedsRSYLPGSPEVLISAVRPEGAFHQWREDPPRELSIALVADERFGWVTGRIGAS
Ga0209069_1004248133300027915WatershedsFLSFAVRPEGACRQWREDPPRELSIALVADERFGRVTGRIEAS
Ga0307310_1051108223300028824SoilPDGAYHQWRKIPPRELLIDLVADERFVWATERAEAS
Ga0311357_1043384323300030524PalsaTVRPDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS
Ga0102760_1078813613300031039SoilVQKIFIYAVRPEGAYRQWRKDPSRELSIALVADERFGRATGRIEAS
Ga0302324_10098572513300031236PalsaPVMAVRPEGAKHQWRRVPPRELSIDLVADERFGRVTGRAGAS
Ga0302187_1008165713300031259BogKNYAVRPEGAFHQWRRVPPRELSIALVADERFGRATGGTEAS
Ga0318538_1073846523300031546SoilVAPEGLVFLIFAVRPEGAFHQWREDPPRELSIALVADERFGWATGWIEAS
Ga0307484_11117713300031663Hardwood Forest SoilDGAYHQWRKDPSRELSIALVADERFGRVTGWIEAS
Ga0318574_1041249123300031680SoilILTCVVRPEGAFPQWRKDPSRELSIALVADERFGRVTGWTGAS
Ga0307474_1156058713300031718Hardwood Forest SoilFHAPPILFFAVRPEGAFHQWREDPPRELSIALVADERFGWVTNRIEAS
Ga0316578_1060737623300031728RhizosphereFFSPDYAVRPEGAYHQWRKIPPRELSIDLVADERFGWATGRVEAS
Ga0318509_1015736913300031768SoilRQHELHSRSTKILISAVRPEGAYHQWRKDPSRELSMALVADDRFSRVTGWIEAS
Ga0318546_1027689113300031771SoilAEVKIYAVRPEGAFHQWRKDPSRELSIALVADERFGRVTGWTGAS
Ga0318564_1040523213300031831SoilYVDAHPWRKIPPRELSIDLVADERFGRAIERTEAS
Ga0318558_1033367413300032044SoilAIFLTFAVRPEGAFHQWREDPPRELSIALVADERFGWATGWIEAS
Ga0307472_10020261723300032205Hardwood Forest SoilMYIRTVRLDGAYYQWRKDPPRELSIDLVADERFGRAIGRIEAS
Ga0335080_1138413613300032828SoilHSRASRFVKILEFAVRPEGADHQWREVPPRELSIALVADERFGWVTGWIEAS
Ga0335073_1075505413300033134SoilSIVPEIKIFAVRPEGADHQWREVPPRELSIALVADERFGRLTGWIEAS
Ga0272423_108178623300033168RockNSAVRPEGADHQWRRVPPRELSIALVADERFGRVTDWIEAS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.