3300001126: Marine microbial communities from the Deep Atlantic Ocean - MP0440

Overview

Basic Information

• IMG/M Taxon OID: 3300001126
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053074 | Gp0054618 | Ga0000807
• Sample Name: Marine microbial communities from the Deep Atlantic Ocean - MP0440
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 22609154
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Deep Ocean Microbial Communities From The Global Malaspina Expedition
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: East of Rio de Janeiro, Brazil, South Atlantic Ocean
• Coordinates
  • Lat. (^o): -22.97
  • Long. (^o): -36.95
  • Alt. (m): N/A
  • Depth (m): 3906.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084703	Metagenome / Metatranscriptome	112	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI12156J13080_102544	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter	1153

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12156J13080_102544	JGI12156J13080_1025443	F084703	SSLPQGLFSTTDPCFLPGKLEPLGFSSPGQLRVAS*