3300001034: Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN607

Overview

Basic Information

• IMG/M Taxon OID: 3300001034
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053063 | Gp0054521 | Ga0002566
• Sample Name: Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN607
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 926756
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): grassland biome → land → fertilized soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Gorham, Kansas, USA
• Coordinates
  • Lat. (^o): 39.05
  • Long. (^o): -99.1
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013868	Metagenome / Metatranscriptome	267	Y
F087170	Metagenome / Metatranscriptome	110	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI12356J13136_10041	Not Available	764
JGI12356J13136_10092	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	563

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12356J13136_10041	JGI12356J13136_100413	F013868	MNGLSAQGLADLAGVTEAEVRRLVDLGILVARDGAGPFLETDVQKVRLATACEQAGLPMDGIAAAVQQGRLSFAFLEAAPYRRWAVRSARTYRQVSQEAGVPLELLGSFLEAIGFARMAPDEPIR
JGI12356J13136_10092	JGI12356J13136_100921	F087170	LTYCRPTGRLDPNPADLAYGSIDLAALEYRARRGEIILLYEDETILWRFALPRA