NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000966

3300000966: Marine microbial communities from the Deep Atlantic Ocean - MP0145



Overview

Basic Information
IMG/M Taxon OID3300000966 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054787 | Ga0000816
Sample NameMarine microbial communities from the Deep Atlantic Ocean - MP0145
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size15807645
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae1
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationWest of Cape Verde, Atlantic Ocean
CoordinatesLat. (o)14.52Long. (o)-26.0Alt. (m)N/ADepth (m)4005.01
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069480Metagenome124N
F082562Metagenome113N
F084715Metagenome / Metatranscriptome112Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12025J13092_103145All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae972Open in IMG/M
JGI12025J13092_104876All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium664Open in IMG/M
JGI12025J13092_106326Not Available544Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12025J13092_103145JGI12025J13092_1031452F069480MPNYIEFIDRIYILELCKDVKRVEGNAGQILDEAPKNKPYNTMKTDFFSVFKLVVFL*
JGI12025J13092_104876JGI12025J13092_1048761F082562MNNIILMKTIILGILITLXTNLFAQTNDSLRNYFLDIELSIIHPILGGFGGTIGIERNHSSFGVMGFGTKLNHMMKHYFIEDAEELAVYNWGVELYSDYYIKQNHRGLFIGSLVSINGFRFTDIPNPQTILVLYAVPRVGYRICLPKKLNAFYFQPSLTAHIKFWDNQEQFLYREIDTKSIFLLSQLTFGMKI*
JGI12025J13092_106326JGI12025J13092_1063263F084715ATKVIPIIASIIFVLEFEVNNPTAHVNITRDITLGFISNMKDFI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.