Basic Information | |
---|---|
IMG/M Taxon OID | 3300000966 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0054787 | Ga0000816 |
Sample Name | Marine microbial communities from the Deep Atlantic Ocean - MP0145 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 15807645 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1 |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine water body → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | West of Cape Verde, Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 14.52 | Long. (o) | -26.0 | Alt. (m) | N/A | Depth (m) | 4005.01 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069480 | Metagenome | 124 | N |
F082562 | Metagenome | 113 | N |
F084715 | Metagenome / Metatranscriptome | 112 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
JGI12025J13092_103145 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 972 | Open in IMG/M |
JGI12025J13092_104876 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 664 | Open in IMG/M |
JGI12025J13092_106326 | Not Available | 544 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
JGI12025J13092_103145 | JGI12025J13092_1031452 | F069480 | MPNYIEFIDRIYILELCKDVKRVEGNAGQILDEAPKNKPYNTMKTDFFSVFKLVVFL* |
JGI12025J13092_104876 | JGI12025J13092_1048761 | F082562 | MNNIILMKTIILGILITLXTNLFAQTNDSLRNYFLDIELSIIHPILGGFGGTIGIERNHSSFGVMGFGTKLNHMMKHYFIEDAEELAVYNWGVELYSDYYIKQNHRGLFIGSLVSINGFRFTDIPNPQTILVLYAVPRVGYRICLPKKLNAFYFQPSLTAHIKFWDNQEQFLYREIDTKSIFLLSQLTFGMKI* |
JGI12025J13092_106326 | JGI12025J13092_1063263 | F084715 | ATKVIPIIASIIFVLEFEVNNPTAHVNITRDITLGFISNMKDFI* |
⦗Top⦘ |