| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000660 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0075432 | Gp0054715 | Ga0001939 |
| Sample Name | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 1426043 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | forest biome → tropical forest → forest soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Luquillo Experimental Forest Soil, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 18.0 | Long. (o) | -65.0 | Alt. (m) | N/A | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000466 | Metagenome / Metatranscriptome | 1105 | Y |
| F007624 | Metagenome / Metatranscriptome | 348 | N |
| F028105 | Metagenome | 192 | Y |
| F065994 | Metagenome / Metatranscriptome | 127 | Y |
| F085267 | Metagenome | 111 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI12415J11908_10001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3289 | Open in IMG/M |
| JGI12415J11908_10043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1413 | Open in IMG/M |
| JGI12415J11908_10135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 832 | Open in IMG/M |
| JGI12415J11908_10248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
| JGI12415J11908_10344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 529 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI12415J11908_10001 | JGI12415J11908_100014 | F007624 | REGGRLCSEPMQLREGSFHGPRPGCPEHPKQRVHRHGFYVRFENCDSQRRLRIERFVCPRCGRTLSILPKNRLPYIAVNATLVESEFDARTSGTDPPSSSEKERGCLRRAFERFAARVTPVCALLGQMITRIKPSVGECWKELRQLDNLEGILLLLGTKFNTSLLADYRCVQSGF* |
| JGI12415J11908_10043 | JGI12415J11908_100431 | F085267 | MSFLRHGEIYPWHEGTISRPCPRPSQWMSFQPVIPGGLLSSRARVRFTSRRH |
| JGI12415J11908_10135 | JGI12415J11908_101352 | F028105 | GGFNRSTQHLLILLEKEVCDGGDCTDMVHAAAEG* |
| JGI12415J11908_10248 | JGI12415J11908_102481 | F000466 | MAHLLTYMTTPEAWQRWKKLPSQGVVKRDWVPTGRIDFATRFYGNLEDSDQPSEFKLIVEERRIVESITGNENLEIQWRLATLNEAKVVVAQYHKYLSENSLIKSVFDEPASLPPPKRIQKIQESTAA* |
| JGI12415J11908_10344 | JGI12415J11908_103443 | F065994 | MPVERRGQVTDVGSEPTGNRRSSNSRREAAAFVRWHEPDDARVSRPD |
| ⦗Top⦘ |