3300000205: Feedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - Passage 4_Xylan

Overview

Basic Information

• IMG/M Taxon OID: 3300000205
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053053 | Gp0053410 | Ga0025999
• Sample Name: Feedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - Passage 4_Xylan
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 125878829
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Feedstock Adapted Compost Microbial Communities From Newby Island Compost Facility, Milpitas Ca
• Type: Engineered
• Taxonomy: Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Feedstock Adapted Compost Microbial Communities From Newby Island Compost Facility, Milpitas Ca

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Newby Island compost facility, Milpitas, CA
• Coordinates
  • Lat. (^o): 37.454581
  • Long. (^o): -121.928712
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001784	Metagenome / Metatranscriptome	635	Y
F096818	Metagenome	104	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
NICFPass4XylDRAFT_c001189	All Organisms → cellular organisms → Bacteria	14422
NICFPass4XylDRAFT_c026922	Not Available	772

Sequences

Scaffold ID	Protein ID	Family	Sequence
NICFPass4XylDRAFT_c001189	NICFPass4XylDRAFT_0011898	F001784	MGXVIHVAFGIEREWERAREHAIDGLVTIGALFGDDEALMRAKAECVYQLLRRIVEDMPPLQITTALPDDLSEGQLALVTDALKSAAHKGIQVAMMHSVEALMNSIYDLCTSKLQQPEL
NICFPass4XylDRAFT_c026922	NICFPass4XylDRAFT_0269222	F096818	LLAYGAGSAAANRTIYPRGWPPHGTGVSRSWGPSPLLYWAKVGFEKWWLWRYF