| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000144 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046785 | Gp0054025 | Ga0026199 |
| Sample Name | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 1000m |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 17957835 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine aphotic zone → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | P4, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 48.65 | Long. (o) | -126.666667 | Alt. (m) | N/A | Depth (m) | 1000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F100407 | Metagenome / Metatranscriptome | 102 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| LPjun08P41000mDRAFT_c100010 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 10235 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| LPjun08P41000mDRAFT_c100010 | LPjun08P41000mDRAFT_10001013 | F100407 | MTRPYYISATIIPLFYSLIGVIFLFAPEIPSTDISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWVIFGINIFFICLLQYEKNQSKK* |
| ⦗Top⦘ |