NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100407

Metagenome / Metatranscriptome Family F100407

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100407
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 125 residues
Representative Sequence MVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKK
Number of Associated Samples 84
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.90 %
% of genes near scaffold ends (potentially truncated) 26.47 %
% of genes from short scaffolds (< 2000 bps) 54.90 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.451 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater
(19.608 % of family members)
Environment Ontology (ENVO) Unclassified
(68.627 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.314 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 76.19%    β-sheet: 0.00%    Coil/Unstructured: 23.81%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01451LMWPc 43.14
PF13715CarbopepD_reg_2 26.47
PF01551Peptidase_M23 8.82
PF02769AIRS_C 2.94
PF12072RNase_Y_N 0.98
PF02562PhoH 0.98
PF00468Ribosomal_L34 0.98
PF02955GSH-S_ATP 0.98
PF05164ZapA 0.98
PF00012HSP70 0.98
PF01035DNA_binding_1 0.98
PF05036SPOR 0.98
PF01553Acyltransferase 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0189Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamilyTranslation, ribosomal structure and biogenesis [J] 1.96
COG0230Ribosomal protein L34Translation, ribosomal structure and biogenesis [J] 0.98
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 0.98
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 0.98
COG1702Phosphate starvation-inducible protein PhoH, predicted ATPaseSignal transduction mechanisms [T] 0.98
COG1875Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domainsGeneral function prediction only [R] 0.98
COG3027Cell division protein ZapA, inhibits GTPase activity of FtsZCell cycle control, cell division, chromosome partitioning [D] 0.98
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.45 %
UnclassifiedrootN/A22.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2236876010|none_p0245471Not Available578Open in IMG/M
3300000117|DelMOWin2010_c10162593Not Available723Open in IMG/M
3300000141|LPjun08P41300mDRAFT_c1000324All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes9331Open in IMG/M
3300000144|LPjun08P41000mDRAFT_c100010All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes10235Open in IMG/M
3300000225|SI34jun09_120mDRAFT_1000274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes23092Open in IMG/M
3300000254|SI34jun09_100mDRAFT_1001549All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae8696Open in IMG/M
3300000262|LP_A_09_P04_1300DRAFT_1008132All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin542438Open in IMG/M
3300000262|LP_A_09_P04_1300DRAFT_1017747Not Available1320Open in IMG/M
3300000930|BpDRAFT_10092723All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3391Open in IMG/M
3300001352|JGI20157J14317_10013914All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales5012Open in IMG/M
3300003514|FS821DNA_1015625All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales2401Open in IMG/M
3300003539|FS891DNA_10021081All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae4334Open in IMG/M
3300003539|FS891DNA_10076205All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3469Open in IMG/M
3300004097|Ga0055584_100295550All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1661Open in IMG/M
3300004097|Ga0055584_102229943All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium558Open in IMG/M
3300004279|Ga0066605_10154350All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300005239|Ga0073579_1094639All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5908Open in IMG/M
3300005402|Ga0066855_10033111Not Available1530Open in IMG/M
3300005429|Ga0066846_10098194All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin541014Open in IMG/M
3300005431|Ga0066854_10016625All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin542426Open in IMG/M
3300005837|Ga0078893_10402069All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes7503Open in IMG/M
3300007558|Ga0102822_1113094Not Available639Open in IMG/M
3300007637|Ga0102906_1022942All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin541899Open in IMG/M
3300007692|Ga0102823_1019417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1889Open in IMG/M
3300007758|Ga0105668_1047351All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3164Open in IMG/M
3300007863|Ga0105744_1066943All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin54886Open in IMG/M
3300007956|Ga0105741_1172129All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium532Open in IMG/M
3300007962|Ga0102907_1005647All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales3848Open in IMG/M
3300007962|Ga0102907_1115498Not Available697Open in IMG/M
3300008224|Ga0105350_10069283All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1501Open in IMG/M
3300008224|Ga0105350_10331979Not Available556Open in IMG/M
3300008253|Ga0105349_10243115Not Available749Open in IMG/M
3300009003|Ga0102813_1015586All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin542906Open in IMG/M
3300009052|Ga0102886_1004026All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5668Open in IMG/M
3300009079|Ga0102814_10141136All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin541318Open in IMG/M
3300009080|Ga0102815_10257239All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes963Open in IMG/M
3300009420|Ga0114994_10987947Not Available544Open in IMG/M
3300009440|Ga0115561_1113567All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300009442|Ga0115563_1178423Not Available831Open in IMG/M
3300009449|Ga0115558_1036946All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin542304Open in IMG/M
3300009498|Ga0115568_10084319All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1599Open in IMG/M
3300009508|Ga0115567_10605819Not Available660Open in IMG/M
3300020165|Ga0206125_10000099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes110690Open in IMG/M
3300020165|Ga0206125_10023106All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3634Open in IMG/M
3300020165|Ga0206125_10110235All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin541152Open in IMG/M
3300020175|Ga0206124_10000109All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes62718Open in IMG/M
3300020396|Ga0211687_10095504All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1264Open in IMG/M
3300021068|Ga0206684_1100921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes976Open in IMG/M
3300021084|Ga0206678_10025330All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3317Open in IMG/M
3300021084|Ga0206678_10281265Not Available804Open in IMG/M
3300021084|Ga0206678_10376974Not Available670Open in IMG/M
3300021084|Ga0206678_10445475All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium603Open in IMG/M
3300021085|Ga0206677_10104667All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin541330Open in IMG/M
3300021085|Ga0206677_10133270All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Pedobacter1129Open in IMG/M
3300021085|Ga0206677_10210066Not Available827Open in IMG/M
3300021087|Ga0206683_10102143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1564Open in IMG/M
3300021087|Ga0206683_10120067All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin541422Open in IMG/M
3300021089|Ga0206679_10032698All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3243Open in IMG/M
3300021089|Ga0206679_10432147All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300021169|Ga0206687_1680347All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae1579Open in IMG/M
3300021345|Ga0206688_10527079Not Available803Open in IMG/M
3300021352|Ga0206680_10294069Not Available630Open in IMG/M
3300021359|Ga0206689_10218101All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1665Open in IMG/M
3300021365|Ga0206123_10228609Not Available816Open in IMG/M
(restricted) 3300022920|Ga0233426_10003844All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia11573Open in IMG/M
(restricted) 3300022931|Ga0233433_10399476Not Available540Open in IMG/M
(restricted) 3300022933|Ga0233427_10018427All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae4399Open in IMG/M
(restricted) 3300022933|Ga0233427_10027281All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3361Open in IMG/M
(restricted) 3300023109|Ga0233432_10066861All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2168Open in IMG/M
3300024346|Ga0244775_10051146All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3596Open in IMG/M
3300024348|Ga0244776_10365437Not Available967Open in IMG/M
3300025639|Ga0209495_1022176All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2685Open in IMG/M
3300025667|Ga0209043_1144379Not Available595Open in IMG/M
3300025673|Ga0209494_1074893Not Available1071Open in IMG/M
3300025676|Ga0209657_1100280All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin54892Open in IMG/M
3300025709|Ga0209044_1203195All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium560Open in IMG/M
3300025876|Ga0209223_10001268All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes27964Open in IMG/M
3300025880|Ga0209534_10000363All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes54483Open in IMG/M
3300025890|Ga0209631_10101612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1656Open in IMG/M
3300026262|Ga0207990_1016559All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin542393Open in IMG/M
3300027170|Ga0208963_1003780All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3304Open in IMG/M
3300027191|Ga0208021_1057595All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium578Open in IMG/M
3300027233|Ga0208678_1009035All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2601Open in IMG/M
3300027234|Ga0208170_1005528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3136Open in IMG/M
3300027251|Ga0208809_1003839All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2937Open in IMG/M
3300027253|Ga0208680_1017484All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin541481Open in IMG/M
3300027298|Ga0208970_1002724All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4333Open in IMG/M
3300027501|Ga0208948_1001404All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes9990Open in IMG/M
3300027506|Ga0208973_1012218All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2832Open in IMG/M
3300027553|Ga0208947_1003539All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5870Open in IMG/M
3300027553|Ga0208947_1104450All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300027572|Ga0208964_1004088All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5101Open in IMG/M
3300027582|Ga0208971_1004785All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes6245Open in IMG/M
3300028196|Ga0257114_1019736All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3331Open in IMG/M
3300028287|Ga0257126_1015419All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3859Open in IMG/M
3300031766|Ga0315322_10570611All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin54729Open in IMG/M
3300031851|Ga0315320_10112650All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales2070Open in IMG/M
3300031851|Ga0315320_10439101All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium BACL11 MAG-121001-bin54895Open in IMG/M
3300032048|Ga0315329_10519971Not Available633Open in IMG/M
3300032073|Ga0315315_10006067All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes11150Open in IMG/M
3300032088|Ga0315321_10346511All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium936Open in IMG/M
3300032088|Ga0315321_10383148Not Available877Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater19.61%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine14.71%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine12.75%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine5.88%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.90%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater4.90%
Methane Seep MesocosmEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm4.90%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.90%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater4.90%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine3.92%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.94%
Diffuse Hydrothermal Flow Volcanic VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent2.94%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine1.96%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.96%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.96%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.98%
Background SeawaterEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater0.98%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.98%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine0.98%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.98%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.98%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2236876010Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-0p1-Hyp-75mEnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000141Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 1300mEnvironmentalOpen in IMG/M
3300000144Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 1000mEnvironmentalOpen in IMG/M
3300000225Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 120mEnvironmentalOpen in IMG/M
3300000254Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100mEnvironmentalOpen in IMG/M
3300000262Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_1300EnvironmentalOpen in IMG/M
3300000930Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16mEnvironmentalOpen in IMG/M
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300003514Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS821_Marshmallow_DNAEnvironmentalOpen in IMG/M
3300003539Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS891_Anemone_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005402Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73EnvironmentalOpen in IMG/M
3300005429Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV76EnvironmentalOpen in IMG/M
3300005431Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75EnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007637Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007758Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300007962Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02EnvironmentalOpen in IMG/M
3300008224Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1E Hudson CanyonEnvironmentalOpen in IMG/M
3300008253Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson CanyonEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009052Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300021068Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015EnvironmentalOpen in IMG/M
3300021084Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021089Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021352Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300022931 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MGEnvironmentalOpen in IMG/M
3300022933 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025639Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1E Hudson Canyon (SPAdes)EnvironmentalOpen in IMG/M
3300025667Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025673Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon (SPAdes)EnvironmentalOpen in IMG/M
3300025676Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025709Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_130m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025876Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026262Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 (SPAdes)EnvironmentalOpen in IMG/M
3300027170Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C43A7_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027191Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes)EnvironmentalOpen in IMG/M
3300027233Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027234Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027251Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027253Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027298Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027501Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_17_M020 (SPAdes)EnvironmentalOpen in IMG/M
3300027506Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027553Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027572Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_08_M0_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027582Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028287Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120mEnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032048Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
none_024547112236876010Marine EstuarineMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLNLPYEKIKIPLLFTQEIGVLFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYIKAPQLFGNFWD
DelMOWin2010_1016259323300000117MarineMVKPYFISATLVPAFYFMVGVIFIFAPEIPSADLKLPYEKIKIPLLFTQEIGILFIIFSILIRQIYNLSKKVYLLMNNTFKFVLLLSALICPYLYYYTKAPQLLIIFGINFCFIVLLQYEKFRAKKLL*
LPjun08P41300mDRAFT_100032493300000141MarineMTRPYYISATIIPLFYSLIGVIFLFAPEIPSADISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWLFLE*
LPjun08P41000mDRAFT_100010133300000144MarineMTRPYYISATIIPLFYSLIGVIFLFAPEIPSTDISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWVIFGINIFFICLLQYEKNQSKK*
SI34jun09_120mDRAFT_1000274143300000225MarineMVKPYFISATLVPAFYFIVGVIFTFVPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYEISKEVYLLMNNTFKFVLLLASLISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYG*
SI34jun09_100mDRAFT_100154963300000254MarineMVKPYFISATLVPAFYFIVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYEISKEVYLLMNNTFKFVLLLASLISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYG*
LP_A_09_P04_1300DRAFT_100813213300000262MarineMTRPYYISATIIPLFYSLIGVIFLFAPEIPSADISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWGIFGINIFFICLLQYEKNQSKK*
LP_A_09_P04_1300DRAFT_101774743300000262MarineCNRKILKMTKPFYISATIIPLFYLLIGIIFVFAPEIPSADISPAEKMMQIPLLFTQEIGVLFVVIAIFFRQIFSVSRETYLLMNNTFKFTLFLLALIAPYLYYYTKAPQLLVIFGINIFFICLLQYEKNQSKK*
BpDRAFT_1009272343300000930Freshwater And MarineMVKPYFISATLVPAFYFMVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLAALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYG*
JGI20157J14317_1001391423300001352Pelagic MarineMIKLYYISATLVPAFYFMVGFVFVFVPEIPSADLKIPYEKIKIPLLFTQEIGIFFIIFSILIRQIYNKSKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLFVIFGINIFFIILLHYEKVKAKK*
FS821DNA_101562523300003514Diffuse Hydrothermal Flow Volcanic VentMTRPYYISATIIPLFYSLIGVIFLFAPEIPSADISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWSIFGINIFFICLLQYEKNQSKK*
FS891DNA_1002108123300003539Diffuse Hydrothermal Flow Volcanic VentMTRPYYISATIIPLFYSLIGVIFLFAPEIPSADISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISKETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWVIFGINIFFICLLQYEKNQSKK*
FS891DNA_1007620523300003539Diffuse Hydrothermal Flow Volcanic VentMIKKYFISATLVPAFYFMVGVVFTFVPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIVLLQYEKVQAKK*
Ga0055584_10029555023300004097Pelagic MarineMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGILFIIFSILIRQIYNLSKKVYLLMNNTFKFVLLLSALICPYLYYSTKAPQLLIIFGINFCFIVLLQYEKFRAKKLL*
Ga0055584_10222994313300004097Pelagic MarineLVPAFYFMVGFVFVFVPEIPNADLKIPYEKIKFPLLFTQEIGIFFIIFSILIRQIYNKSKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLFVIFGINIFFIILLHYEKVKAKK*
Ga0066605_1015435023300004279MarineMIKPYFISATLVPAFYFIVGVVFTFVPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIALLQYEKVKAKK*
Ga0073579_109463923300005239MarineMIKPYFISATLVPAFYFMVGIVFTFVPEIPSADLKIPYEKIKIPLLFTQEIGILFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCIIFGINIFFIVLLQYEKVQANK*
Ga0066855_1003311143300005402MarineMTRPYYISATIIPLFYSLIGVIFLFAPEIPSADISPAEKMMKIPLLFTQEIGILFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWGIFVINIFFICLLQYEKNQSKK*
Ga0066846_1009819423300005429MarineMFAIVKFKIMTRPFYISAMIIPLFYFFIGVIFLFAPEIPSSDISPAEKMMQIPLLFTQEIGVLFVIIAIFYRQIFNISRETYLLMNNTFKLTLFLLALIGPYLYYYIKTPQLLVIFGINVFFICLLQYEKYQSKK*
Ga0066854_1001662523300005431MarineMTRPYYISATIIPLFYSLIGVIFLFAPEIPSADISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWVIFGINIFFICLLQYEKNQSKK*
Ga0078893_1040206943300005837Marine Surface WaterMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLLVIFGINIFFIVLLQYEKLRAKK*
Ga0102822_111309423300007558EstuarineFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYEISKEVYLLMNNTFKFVLLLASLISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYE*
Ga0102906_102294233300007637EstuarineMARPYYISVTIIPLFYSLIGVIFLFAPEIPSADISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYHTKAPQLWVIFGINIFFICLLQYEKNQSKK*
Ga0102823_101941733300007692EstuarineMVKPYFISATLVPAFYFMVGVIFIFAPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYEISKEVYLLMNNTFKFVLLLASLISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYE*
Ga0105668_104735113300007758Background SeawaterMTRPYYISPTIIPLFYSLIGVIFLFAPEIPSADISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWVIFGINIFFICLLQYEKNQSKK*
Ga0105744_106694323300007863Estuary WaterMIKPYFISATLVPAFYFMVGVVFTFFPEIPSADLKLSFEKIKIPLLFTQESGILFISFSILLRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKASQLCVIFGINIFFIALLQYE
Ga0105741_117212923300007956Estuary WaterPYFISATLVPVFYFMVGVVFTFAPEIPSADLKLPYEKIKIPLLFTQEIGILFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKASQLCVIFGINIFFIALLQYEKVKAKK*
Ga0102907_100564723300007962EstuarineMVKPYFISAILVPAFYFIVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIALLQYEKVKAKK*
Ga0102907_111549813300007962EstuarineMARPYYISATIIPLFYSLIGVIFLFAPEIPSADISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWVIFGINIFFICLLQYEKNQSQK*
Ga0105350_1006928323300008224Methane Seep MesocosmMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIALLQYEKVKAKK*
Ga0105350_1033197923300008224Methane Seep MesocosmMFAIVKFKIMTRPFYISATLIPLFYLLIGVIFVFAPEIPAADISPAEKMMQIPLLFTQEIGVLFVVIAILIRQIFSISRETYLLMNNTFKLTLFLLALIAPYLYFYTKTPQLLVIFGINVFFICL
Ga0105349_1024311513300008253Methane Seep MesocosmMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKK*
Ga0102813_101558623300009003EstuarineMVKPYFISATLVPAFYFIVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIALLQYEKVKAKK*
Ga0102886_100402633300009052EstuarineMVKPYFISATLVPAFYFIVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLAALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYG*
Ga0102814_1014113613300009079EstuarineMIKPYFISATLVPAFYFIVGVVFTFVPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLAALISPYLYCYTKAPQLLIIFGI
Ga0102815_1025723933300009080EstuarineVPAFYFILGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYEISKEVYLLMNNTFKFVLLLASLISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYG*
Ga0114994_1098794723300009420MarineMVKPYFISATLVPAFYFMVGVVFTFVPEVPSSDLNLSYEKIKIPLLFTQEIGILFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALINPYLYYYTKAPQLCVIFGINIFFIILLQ
Ga0115561_111356713300009440Pelagic MarineMIKLYYISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYFLMNNTFKFVLLLSALICPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKK*
Ga0115563_117842313300009442Pelagic MarineISATLVPAFYFIVGVIFTFFPKIPSADLKLPPQKIKIPLLFTQEIGVFFIIFSILFRQIYNISTEVYLLMNNTFKFVLLLAALVCPYLYYYTKAPQLLLIFGINICFIILFQYEKLRAKNNYEKSTDTLYR*
Ga0115558_103694623300009449Pelagic MarineMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYFLMNNTFKFVLLLAALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKK*
Ga0115568_1008431933300009498Pelagic MarineFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLITQEIGILFIIFSILIRQIYNLSKKVYLLMNNTFKFVLLLSALICPYLYYSTKAPQLLIIFGINFCFIVLLQYEKFRAKKLL*
Ga0115567_1060581923300009508Pelagic MarineFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGILFIIFSILIRQIYNLSKKVYLLMNNTFKFVLLLSALICPYLYYSTKAPQLLIIFGINFCFIVLLQYEKFRAKKLL*
Ga0206125_10000099273300020165SeawaterMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYFLMNNTFKFVLLLAALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKK
Ga0206125_1002310653300020165SeawaterMLKSNFFSATLVPAFYLMIGVVFIFAPEIPSADLKIEYEKIKISLLFTQEIGVFFIIFSILLRQIYNTSKEVYLLMNNTFKFVLLLAAIVCPYLYYHTKASQLLVIFGINICFIVLLQYEKLQAKK
Ga0206125_1011023513300020165SeawaterMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLSALISPYFYYYTKAPQLLIIFGINICFIVLLQYEKLRDKK
Ga0206124_10000109203300020175SeawaterMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGILFIIFSILIRQIYNLSKKVYLLMNNTFKFVLLLSALICPYLYYYTKAPQLLIIFGINFCFIVLLQYEKFRAKKLL
Ga0211687_1009550433300020396MarineMIKPYFISATLVPAFYFMVGVVFTFVPEIPSADLKIPYEKIKIPLLFTQEIGILFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIALLQYEKLKAKK
Ga0206684_110092123300021068SeawaterMVKPYFISATLVPAFYFIVGVIFTFAPEIPSADLKIPYEKIKIPLLFTQEIGVFFIIFSILFKQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKK
Ga0206678_1002533053300021084SeawaterMARPYYISATIIPLFYSLIGVIFLFAPEIPSADISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWVIFGINIFFICLLQYEKNQSKK
Ga0206678_1028126523300021084SeawaterMVKPYFISATLVPAFYFIVGVIFTFAPEIPSADLKIPYEKIKIPLLFTQEIGVFFIIFSILFKQIYNISKEVYLLMNNTFKFVLLLAALISPYLYYYTKAPQLLIIFGINICFIVLLQYEKVQAKK
Ga0206678_1037697423300021084SeawaterPKIKIMIKPYFISATLVPAFYFMVGVVFTFVPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKKLL
Ga0206678_1044547523300021084SeawaterPKIKIMIKPYFISATLVPAFYFMVGVVFTFVPEIPSADLKLPYEKIKIPLLFTQEIGIFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIVLLQYEKVQAKK
Ga0206677_1010466723300021085SeawaterVVKPYFISATLVPAFYFMVGILFTFAPEIPSADLKIPYEKIEIPLLFTQEFGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLAALISPYLHYYTKAPQLLVIFGINISFILLLQYEKLQAKK
Ga0206677_1013327023300021085SeawaterMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILLRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKK
Ga0206677_1021006623300021085SeawaterMIKPYFISATLVPVFYFMVGVVFTFAPEIPSADLKLPYEKIKIPLLFTQEIGILFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIALLQYEKVKAKK
Ga0206683_1010214333300021087SeawaterMIKPYFISATLVPAFYFMVGVVFTFVPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKKLL
Ga0206683_1012006723300021087SeawaterMVKPYFISATLVPAFYFIVGVIFTFAPEIPSADLKIPYEKIKIPLLFTQEIGVFFIIFSILFKQIYNISKEVYLLMNNTFKFVLLLAALISPYLYYYTKAPQLLIIFGINI
Ga0206679_1003269833300021089SeawaterMIKPYFISATLVPAFYFMVGVVFTFVPEIPSADLKLPYEKIKIPLLFTQEIGIFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIVLLQYEKVQAKK
Ga0206679_1043214713300021089SeawaterMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLNLPYEKIKIPLLFTQEIGVLFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYIKAPQLLVIFGINICFIFLLQYEKLRAKK
Ga0206687_168034713300021169SeawaterVKPYFISATLVPAFYFIVGVIFTFAPEIPSADLKIPYEKIKIPLLFTQEIGVFFIIFSILFKQIYNISKEVYLLMNNTFKFVLLLAALISPYLYYYTKAPQLLIIFGINICFIVLLQYEKVQAKK
Ga0206688_1052707913300021345SeawaterFISATLVPAFYFMVGVVFTFVPEIPSADLKLPYEKIKIPLLFTQEIGIFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINTFFIVLLQYEKVQAK
Ga0206680_1029406913300021352SeawaterMARPYYISATIIPLFYSLIGVIFLFAPEIPSADISPAEKMMKISLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWVIFGINIFFICLLQYEKNQSKK
Ga0206689_1021810113300021359SeawaterPYFISATLVPAFYFMVGVVFTFVPEIPSADLKLPYEKIKIPLLFTQEIGIFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIVLLQYEKVQAKK
Ga0206123_1022860923300021365SeawaterMIKPYFISATLVPAFYFMVGVVFTFFPEIPSSDLKIPYEKIKIPLLFTQEIGILFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALINPYLYYYTKATQLCVIFGINIFFIALLQYEKVKAKKET
(restricted) Ga0233426_1000384483300022920SeawaterMIKPYFISATLVPAFYFIVGVVFTFVPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIALLQYEKVKAKK
(restricted) Ga0233433_1039947613300022931SeawaterMIKPYYISATLVPAFYFMVGFVFVFVPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLFV
(restricted) Ga0233427_1001842763300022933SeawaterMFAIVKFKIMTRPFYISATIIPLFYLLIGIIFVFVPEIPSADISPTKQMMQIPLLFTQEIGVLFVVIAIFFRQIFSISRETYLLMNNTFKLTLFLLALIAPYLYYYTKTPQLLVIFGINVFFICLLQYEKNQSKK
(restricted) Ga0233427_1002728133300022933SeawaterMIKPFFISATLVPAFYLMVGVVFVFVPEIPSSDLNLPYEKIKIPLLFTQEIGVFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFMINIFFIALLQYEKVKAKR
(restricted) Ga0233432_1006686133300023109SeawaterMVKPYFISATLVPAFYFMVGVIFIFAPEIPSADLKIPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLAALISPYLYYHTKAPQLLIIFGINICFIVLLQYEKLRAKK
Ga0244775_1005114633300024346EstuarineMVKPYFISATLVPAFYFIVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYEISKEVYLLMNNTFKFVLLLASLISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYG
Ga0244776_1036543723300024348EstuarineMARPYYISVTIIPLFYSLIGVIFLFAPEIPSADISPAEKIMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYHTKAPQLWVIFGINIFFICLLQYEKNQSKK
Ga0209495_102217623300025639Methane Seep MesocosmMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIALLQYEKVKAKK
Ga0209043_114437913300025667MarineMVKPYFISATLVPAFYFIVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGIFFIIFSILFRQIYEISKEVYLLMNNTFKFVLLLASLISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYG
Ga0209494_107489333300025673Methane Seep MesocosmMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKK
Ga0209657_110028023300025676MarineMARPYYISATIIPLFYSLIGVIFLFAPEIPSADISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFLLALVAPYLYYYTKTPQLLVIFGINVSFIFLLQYEKNQSKK
Ga0209044_120319513300025709MarineVPAFYFIVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYEISKEVYLLMNNTFKFVLLLAALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYG
Ga0209223_10001268253300025876Pelagic MarineMVKPYFISATLVPAFYFIVGVIFTFVPEIPSADLKLPPEKIKIPLLFTQEIGVFFIIFSILFRQIYNISTEVYLLMNNTFKFVLLLAALVCPYLYYYTKAPQLLLIFGINICFIILFQYEKLRAKNNYEKSTDTLYG
Ga0209534_10000363193300025880Pelagic MarineMIKLYYISATLVPAFYFMVGFVFVFVPEIPSADLKIPYEKIKIPLLFTQEIGIFFIIFSILIRQIYNKSKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLFVIFGINIFFIILLHYEKVKAKK
Ga0209631_1010161223300025890Pelagic MarineMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYEKIKIPLLFTQEIGILFIIFSILIRQIYNLSKKVYLLMNNTFKFVLLLSALICPYLYYSTKAPQLLIIFGINFCFIVLLQYEKFRAKKLL
Ga0207990_101655923300026262MarineMTRPYYISATIIPLFYSLIGVIFLFAPEIPSADISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWVIFGINIFFICLLQYEKNQSKK
Ga0208963_100378023300027170MarineMFAIVKFKIMTRPFYISAIIIPLFYFLIGLIFLFAPEIPSSDISPAEKMPQIPLLFTQEIGVLFVVIAIFFRQIFSISRETYLLMNNTFKLTLFLLALVAPYLYYYTKTPQLLVIFGINVFFICLLQYEKNQSKK
Ga0208021_105759523300027191EstuarineMIKPYFISATLVPAFYFIVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQL
Ga0208678_100903513300027233EstuarineLVPAFYFIVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYEISKEVYLLMNNTFKFVLLLASLISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYG
Ga0208170_100552823300027234EstuarineMVKPYFISATLVPAFYFMVGVIFTFAPEIPSADLKLPYQKISIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLAALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYG
Ga0208809_100383923300027251EstuarineMVKPYFISAILVPAFYFIVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYEISKEVYLLMNNTFKFVLLLASLISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYG
Ga0208680_101748423300027253EstuarineMVKPYFISATLVPAFYFIVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYEISKEVYLLMNNTFKFVLLLAALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYE
Ga0208970_100272423300027298MarineMIKPFFISATLVPAFYLMVGVVFVFFPEIPSSDLDLPYEKIKIPLLFTQEIGVFFIIFSILIRQIYNISKEVFLLMNNTFKFVLLLSALISPYLYYYTKAPQLYVIFGINIFFIVLLQYEKVQAKK
Ga0208948_100140483300027501MarineMVKPYFISATLVPAFYFIVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYEISKEVYLLMNNTFKFVLLLASLISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYR
Ga0208973_101221843300027506MarineMIKPYFISATLVPAFYFMVGVVFTFFPEIPSSDLNLSYEKIKIPLLFTQEIGILFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIALLQYEKVKAKK
Ga0208947_100353923300027553MarineMIKPYFISATLVPAFYFMVGVVFSFVPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINTFFIVLLQYEKVQAKK
Ga0208947_110445013300027553MarineMVKPYFISATLVPAFYFIVGVIFTFIPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLAALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLQAKK
Ga0208964_100408863300027572MarineMIKPYFISATLVPAFYFMVGVVFSFVPEIPSADLKLPYEKIKIPLLFTQEIGVFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYG
Ga0208971_100478513300027582MarineMVKPYFISATLVPAFYFIVGVIFTFVPEIPSADLKLPHEKIKIPLLFTQEIGVFFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLASLISPYLYYYTKAPQLLVIFGINICFIVLLQYEKLRAKNNYEKSTDTLYG
Ga0257114_101973623300028196MarineMVKPYFISATLVPAFYFMVGVIFIFAPEIPSADLKIPYEKIKIPLLFTQEIGVFFIIFSILFRQIYNISKEVYLLMNNTFKFVLLLAALISPYLYYHTKAPQFLIIFGINICFIVLLQYEKLRAKK
Ga0257126_101541933300028287MarineMVKPYFISATLVPAFYFMVGVIFIFAPEIPSADLKLPYEKIKIPLLFTQEIGILFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIVLLQYEKVKAKK
Ga0315322_1057061113300031766SeawaterMIKPYFISATLVPAFYFMVGVVFTFVPEIPSADLKLPYEKIKIPLLFTQEIGILFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIVL
Ga0315320_1011265023300031851SeawaterMIKPYFISATLVPVFYFMVGVVFTFAPEIPSADLKLPYEKIKIPLLFTQEIGILFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIAIFQYEKVKAKK
Ga0315320_1043910123300031851SeawaterMFAIVKLKIMTRPFYISAIIIPLFYFLIGVIFVFAPEIPSADISPTEKMTEIPLLFTQEIGVLFVVIAIFFRQIFSVSRETYLLMNNTFRFTLFFLALIAPYLYYYTKTPQLLVIFGINV
Ga0315329_1051997113300032048SeawaterGVIFLFAPEIPSADISPAEKMMKIPLLFTQEIGVLFLIIAIFFRQIFNISRETYLLMNNTFKLALFVLALIAPYLYYYTKAPQLWVIFGINIFFICLLQYEKNQSKK
Ga0315315_1000606733300032073SeawaterVPAFYFMLGFIFVFFPEIPSLDLKIPYEKIKIPLLFTQEIGIFFIILSILIRQIYNISKEVYLLMNNTFKFVVLLSALISPYLYYYTKAPQLCLIFGINIFFIILLQYEKVQAKK
Ga0315321_1034651113300032088SeawaterLIPLFYLLIGVIFVFAPEIPAADISPAEKMMQIPLLFTQEIGVLFVVIAILFRQIFSISRETYLLMNNTFKLALFLLALIAPYLYYYTKTPQLLVIFGINVFFICLLQYEKNQSKR
Ga0315321_1038314823300032088SeawaterMIKPYFISATLVPAFYFMVGVVFTFAPEIPSADLKLPYEKIKIPLLFTQEIGILFIIFSILIRQIYNISKEVYLLMNNTFKFVLLLSALISPYLYYYTKAPQLCVIFGINIFFIAIFQYEKVKAKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.