2088090000: Rangifer tarandus platyrhynchus rumen microbial communities from Svalbard, Norway - Sample 549

Overview

Basic Information

• IMG/M Taxon OID: 2088090000
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0046228 | Gp0051877 | Ga0010749
• Sample Name: Rangifer tarandus platyrhynchus rumen microbial communities from Svalbard, Norway - Sample 549
• Sequencing Status: Permanent Draft
• Sequencing Center: Macrogen
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 299856225
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Rangifer Tarandus Platyrhynchus Rumen Microbial Communities From Svalbard, Norway
• Type: Host-Associated
• Taxonomy: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rangifer Tarandus Platyrhynchus Rumen → Rangifer Tarandus Platyrhynchus Rumen Microbial Communities From Svalbard, Norway

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut

Location Information

• Location: Longyearbyen, Svalbard
• Coordinates
  • Lat. (^o): 78.2166667
  • Long. (^o): 15.6333333
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036881	Metagenome / Metatranscriptome	169	Y
F093041	Metagenome / Metatranscriptome	106	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
SRMUA_GMSDS1U03GOL3O	All Organisms → cellular organisms → Bacteria	527
SRMUA_GMSDS1U03GR1NX	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	508

Sequences

Scaffold ID	Protein ID	Family	Sequence
SRMUA_GMSDS1U03GOL3O	SRMUA_06894150	F036881	LPVSVQLQFFSGADVEFDAVHELFLVAQPNSSSSNGSSIYVYDTNGNLQETLNGFSFSNAFNVVPAHIALNPSKRTGFVDGPSSNVNELQHFTY
SRMUA_GMSDS1U03GR1NX	SRMUA_05074510	F093041	MKLSSPFLACQQYHDDRKAKSQKAFRRAALLRSKTAPLFCPVLIAMSIGRMIQRIIRCQTCRLAAKSIETSIDIAIRCSL