| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2016842005 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045212 | Gp0051383 | Ga0026268 |
| Sample Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP17 Obsidian Pool Prime |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 24421805 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Archaea → DPANN group | 1 |
| All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hot spring → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Yellowstone National Park, WY | |||||||
| Coordinates | Lat. (o) | 44.733519 | Long. (o) | -110.404033 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046219 | Metagenome | 151 | Y |
| F065251 | Metagenome / Metatranscriptome | 128 | Y |
| F090961 | Metagenome | 108 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| YNP17_C3538 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| YNP17_FYNF10409_b1 | All Organisms → cellular organisms → Archaea → DPANN group | 814 | Open in IMG/M |
| YNP17_FYNF9041_b1 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales | 787 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| YNP17_C3538 | YNP17_145310 | F046219 | LLRRAIDLRAALKLGVRVGLDEIRADEFAALVKLEEEQAEFEREKAAMPPH |
| YNP17_FYNF10409_b1 | YNP17_19600 | F065251 | MYLRHFVKGKKKYYYIAKAVRKGTSVIQKSVLYIGTADTLYEKLLNLKKK |
| YNP17_FYNF9041_b1 | YNP17_244910 | F090961 | MTDKITLIMKITKSPKLIDRDQDLWIFYCPFDKKWCKGTRHGYTSEFWSEMYFECEDGHKIEAPGCEMIEK |
| ⦗Top⦘ |