NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2016842005

2016842005: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP17 Obsidian Pool Prime



Overview

Basic Information
IMG/M Taxon OID2016842005 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0045212 | Gp0051383 | Ga0026268
Sample NameHot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP17 Obsidian Pool Prime
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size24421805
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Archaea → DPANN group1
All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomehot springsediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationYellowstone National Park, WY
CoordinatesLat. (o)44.733519Long. (o)-110.404033Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046219Metagenome151Y
F065251Metagenome / Metatranscriptome128Y
F090961Metagenome108Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
YNP17_C3538All Organisms → cellular organisms → Bacteria1095Open in IMG/M
YNP17_FYNF10409_b1All Organisms → cellular organisms → Archaea → DPANN group814Open in IMG/M
YNP17_FYNF9041_b1All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales787Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
YNP17_C3538YNP17_145310F046219LLRRAIDLRAALKLGVRVGLDEIRADEFAALVKLEEEQAEFEREKAAMPPH
YNP17_FYNF10409_b1YNP17_19600F065251MYLRHFVKGKKKYYYIAKAVRKGTSVIQKSVLYIGTADTLYEKLLNLKKK
YNP17_FYNF9041_b1YNP17_244910F090961MTDKITLIMKITKSPKLIDRDQDLWIFYCPFDKKWCKGTRHGYTSEFWSEMYFECEDGHKIEAPGCEMIEK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.