| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2010549000 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0056620 | Gp0052103 | Ga0026419 |
| Sample Name | Rice endophytes microbial communities from Berkeley, California, USA |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 46747680 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Rice Endophytes Microbial Communities From The International Rice Research Institute, Philippines |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Plants → Rhizoplane → Endophytes → Unclassified → Rice Endophytes → Rice Endophytes Microbial Communities From The International Rice Research Institute, Philippines |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Philippines: Los Banos | |||||||
| Coordinates | Lat. (o) | 14.1677 | Long. (o) | -121.2523 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021566 | Metagenome / Metatranscriptome | 218 | Y |
| F080249 | Metagenome / Metatranscriptome | 115 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| RicEn_FSXC3319_g1 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| RicEn_FSXC82502_b1 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| RicEn_FSXC3319_g1 | RicEn_196220 | F080249 | MIDATQRETPMTDNKQNKGTPDRNLISFKQKYEFDYAVKQLQKQIPDTTRQEAKDALAAAAKKISPSEGREKIMRAARKTLRD |
| RicEn_FSXC82502_b1 | RicEn_592700 | F021566 | MFTCKSYDKFTARVLAGLVLAVTIVFGSLTYAVSNVQAYI |
| ⦗Top⦘ |