| Basic Information | |
|---|---|
| Family ID | F021566 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 218 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 218 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.89 % |
| % of genes near scaffold ends (potentially truncated) | 17.89 % |
| % of genes from short scaffolds (< 2000 bps) | 72.94 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.505 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (21.560 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.440 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) (29.817 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 218 Family Scaffolds |
|---|---|---|
| PF13602 | ADH_zinc_N_2 | 50.00 |
| PF00080 | Sod_Cu | 12.39 |
| PF13549 | ATP-grasp_5 | 7.34 |
| PF13302 | Acetyltransf_3 | 6.88 |
| PF02566 | OsmC | 5.96 |
| PF08240 | ADH_N | 2.29 |
| PF00583 | Acetyltransf_1 | 1.38 |
| PF11583 | AurF | 0.92 |
| PF07396 | Porin_O_P | 0.92 |
| PF12704 | MacB_PCD | 0.92 |
| PF13607 | Succ_CoA_lig | 0.92 |
| PF00005 | ABC_tran | 0.92 |
| PF13091 | PLDc_2 | 0.46 |
| PF00850 | Hist_deacetyl | 0.46 |
| PF10617 | DUF2474 | 0.46 |
| PF03060 | NMO | 0.46 |
| PF06974 | WS_DGAT_C | 0.46 |
| PF12860 | PAS_7 | 0.46 |
| PF08002 | DUF1697 | 0.46 |
| PF04952 | AstE_AspA | 0.46 |
| COG ID | Name | Functional Category | % Frequency in 218 Family Scaffolds |
|---|---|---|---|
| COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 12.39 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 5.96 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 5.96 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.92 |
| COG3746 | Phosphate-selective porin | Inorganic ion transport and metabolism [P] | 0.92 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.46 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.46 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.46 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.50 % |
| Unclassified | root | N/A | 44.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2010549000|RicEn_FSXC82502_b1 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300003858|Ga0031656_10000729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 11808 | Open in IMG/M |
| 3300003858|Ga0031656_10009576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4043 | Open in IMG/M |
| 3300003858|Ga0031656_10012462 | All Organisms → cellular organisms → Bacteria | 3560 | Open in IMG/M |
| 3300003858|Ga0031656_10017139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3033 | Open in IMG/M |
| 3300003858|Ga0031656_10120712 | Not Available | 936 | Open in IMG/M |
| 3300003859|Ga0031653_10082394 | Not Available | 847 | Open in IMG/M |
| 3300004026|Ga0055443_10158692 | Not Available | 686 | Open in IMG/M |
| 3300004048|Ga0055494_10000177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4530 | Open in IMG/M |
| 3300004048|Ga0055494_10011721 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300004048|Ga0055494_10047292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 817 | Open in IMG/M |
| 3300004049|Ga0055493_10015266 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300004049|Ga0055493_10087089 | Not Available | 650 | Open in IMG/M |
| 3300004049|Ga0055493_10171069 | Not Available | 506 | Open in IMG/M |
| 3300004050|Ga0055491_10037650 | Not Available | 1038 | Open in IMG/M |
| 3300004051|Ga0055492_10014863 | Not Available | 1263 | Open in IMG/M |
| 3300004071|Ga0055486_10109172 | Not Available | 636 | Open in IMG/M |
| 3300004146|Ga0055495_10050543 | Not Available | 866 | Open in IMG/M |
| 3300004154|Ga0066603_10049213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1797 | Open in IMG/M |
| 3300004481|Ga0069718_10017699 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300004481|Ga0069718_14687451 | Not Available | 838 | Open in IMG/M |
| 3300006224|Ga0079037_100000010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 57853 | Open in IMG/M |
| 3300006224|Ga0079037_100000164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 25197 | Open in IMG/M |
| 3300006224|Ga0079037_100002833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 9749 | Open in IMG/M |
| 3300006224|Ga0079037_100031157 | All Organisms → cellular organisms → Bacteria | 3945 | Open in IMG/M |
| 3300006224|Ga0079037_100063861 | All Organisms → cellular organisms → Bacteria | 2947 | Open in IMG/M |
| 3300006224|Ga0079037_100089240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2556 | Open in IMG/M |
| 3300006224|Ga0079037_100131694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 2160 | Open in IMG/M |
| 3300006224|Ga0079037_100135766 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
| 3300006224|Ga0079037_100272217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1558 | Open in IMG/M |
| 3300006224|Ga0079037_100366056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1356 | Open in IMG/M |
| 3300006224|Ga0079037_100490907 | Not Available | 1177 | Open in IMG/M |
| 3300006224|Ga0079037_100652610 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300006224|Ga0079037_101027742 | Not Available | 816 | Open in IMG/M |
| 3300006224|Ga0079037_101271212 | Not Available | 732 | Open in IMG/M |
| 3300006224|Ga0079037_101549313 | Not Available | 662 | Open in IMG/M |
| 3300006224|Ga0079037_101767465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 618 | Open in IMG/M |
| 3300006224|Ga0079037_101932510 | Not Available | 590 | Open in IMG/M |
| 3300006224|Ga0079037_101934409 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300009009|Ga0105105_10001937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 8529 | Open in IMG/M |
| 3300009009|Ga0105105_10021940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2687 | Open in IMG/M |
| 3300009009|Ga0105105_10573852 | Not Available | 655 | Open in IMG/M |
| 3300009037|Ga0105093_10765951 | Not Available | 558 | Open in IMG/M |
| 3300009075|Ga0105090_10001102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14312 | Open in IMG/M |
| 3300009075|Ga0105090_10003423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 9013 | Open in IMG/M |
| 3300009075|Ga0105090_10004065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 8378 | Open in IMG/M |
| 3300009075|Ga0105090_10010583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 5497 | Open in IMG/M |
| 3300009075|Ga0105090_10026562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3591 | Open in IMG/M |
| 3300009075|Ga0105090_10048071 | All Organisms → cellular organisms → Bacteria | 2665 | Open in IMG/M |
| 3300009075|Ga0105090_10092439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1893 | Open in IMG/M |
| 3300009075|Ga0105090_10125267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1606 | Open in IMG/M |
| 3300009078|Ga0105106_10072894 | All Organisms → cellular organisms → Bacteria | 2528 | Open in IMG/M |
| 3300009078|Ga0105106_10366641 | Not Available | 1040 | Open in IMG/M |
| 3300009078|Ga0105106_10381214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1017 | Open in IMG/M |
| 3300009081|Ga0105098_10078151 | Not Available | 1395 | Open in IMG/M |
| 3300009082|Ga0105099_10736327 | Not Available | 614 | Open in IMG/M |
| 3300009085|Ga0105103_10145944 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300009091|Ga0102851_10418079 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300009091|Ga0102851_10524723 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira | 1222 | Open in IMG/M |
| 3300009091|Ga0102851_10824069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 994 | Open in IMG/M |
| 3300009091|Ga0102851_11150733 | Not Available | 851 | Open in IMG/M |
| 3300009091|Ga0102851_11722718 | Not Available | 704 | Open in IMG/M |
| 3300009091|Ga0102851_13127937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 531 | Open in IMG/M |
| 3300009111|Ga0115026_10983317 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300009120|Ga0117941_1000146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 23529 | Open in IMG/M |
| 3300009131|Ga0115027_10715031 | Not Available | 753 | Open in IMG/M |
| 3300009153|Ga0105094_10108762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1567 | Open in IMG/M |
| 3300009165|Ga0105102_10216246 | Not Available | 964 | Open in IMG/M |
| 3300009165|Ga0105102_10450608 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300009166|Ga0105100_10593491 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300009166|Ga0105100_10808436 | Not Available | 581 | Open in IMG/M |
| 3300009167|Ga0113563_10300582 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300009167|Ga0113563_10306086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 1651 | Open in IMG/M |
| 3300009169|Ga0105097_10172942 | Not Available | 1189 | Open in IMG/M |
| 3300009169|Ga0105097_10248594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 980 | Open in IMG/M |
| 3300009170|Ga0105096_10119094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1321 | Open in IMG/M |
| 3300009170|Ga0105096_10402322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 706 | Open in IMG/M |
| 3300009179|Ga0115028_10010028 | Not Available | 3544 | Open in IMG/M |
| 3300009430|Ga0114938_1007743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 5314 | Open in IMG/M |
| 3300009430|Ga0114938_1027026 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
| 3300009506|Ga0118657_10129547 | All Organisms → cellular organisms → Bacteria | 3641 | Open in IMG/M |
| 3300009506|Ga0118657_10279794 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300009509|Ga0123573_10020648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 13132 | Open in IMG/M |
| 3300009509|Ga0123573_10061448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3959 | Open in IMG/M |
| 3300009509|Ga0123573_10217150 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
| 3300009509|Ga0123573_10738696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 924 | Open in IMG/M |
| 3300009776|Ga0116154_10026385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 2905 | Open in IMG/M |
| 3300009776|Ga0116154_10330085 | Not Available | 654 | Open in IMG/M |
| 3300009868|Ga0130016_10140310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1967 | Open in IMG/M |
| 3300009868|Ga0130016_10368343 | Not Available | 968 | Open in IMG/M |
| 3300010051|Ga0133939_1005550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 29740 | Open in IMG/M |
| 3300010412|Ga0136852_10226879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1859 | Open in IMG/M |
| 3300010412|Ga0136852_10279171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1650 | Open in IMG/M |
| 3300010412|Ga0136852_10794351 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300014264|Ga0075308_1079589 | Not Available | 679 | Open in IMG/M |
| 3300014296|Ga0075344_1057185 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300014298|Ga0075341_1123966 | Not Available | 528 | Open in IMG/M |
| 3300014306|Ga0075346_1175347 | Not Available | 512 | Open in IMG/M |
| 3300014312|Ga0075345_1012568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1494 | Open in IMG/M |
| 3300014312|Ga0075345_1145961 | Not Available | 566 | Open in IMG/M |
| 3300014312|Ga0075345_1166038 | Not Available | 540 | Open in IMG/M |
| 3300014313|Ga0075347_1024925 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300014313|Ga0075347_1139931 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300014316|Ga0075339_1122785 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira | 701 | Open in IMG/M |
| 3300014319|Ga0075348_1011085 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300014319|Ga0075348_1064385 | Not Available | 871 | Open in IMG/M |
| 3300014319|Ga0075348_1073236 | Not Available | 826 | Open in IMG/M |
| 3300014319|Ga0075348_1115864 | Not Available | 685 | Open in IMG/M |
| 3300020048|Ga0207193_1224321 | Not Available | 1453 | Open in IMG/M |
| 3300021346|Ga0210335_1431668 | Not Available | 875 | Open in IMG/M |
| 3300022213|Ga0224500_10009521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4460 | Open in IMG/M |
| 3300025106|Ga0209398_1013231 | All Organisms → cellular organisms → Bacteria | 2644 | Open in IMG/M |
| 3300025106|Ga0209398_1016679 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
| 3300025561|Ga0210119_1067555 | Not Available | 686 | Open in IMG/M |
| 3300025706|Ga0209507_1098753 | Not Available | 818 | Open in IMG/M |
| 3300025715|Ga0209310_1228032 | Not Available | 522 | Open in IMG/M |
| 3300025715|Ga0209310_1239519 | Not Available | 506 | Open in IMG/M |
| 3300025950|Ga0210134_1006520 | Not Available | 1705 | Open in IMG/M |
| 3300025950|Ga0210134_1039414 | Not Available | 658 | Open in IMG/M |
| 3300025956|Ga0210104_1009808 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300025964|Ga0210127_1032780 | Not Available | 619 | Open in IMG/M |
| 3300025966|Ga0210105_1001210 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Sunxiuqinia → Sunxiuqinia indica | 3970 | Open in IMG/M |
| 3300025968|Ga0210103_1003420 | All Organisms → cellular organisms → Bacteria | 2913 | Open in IMG/M |
| 3300025968|Ga0210103_1010411 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300025968|Ga0210103_1072065 | Not Available | 567 | Open in IMG/M |
| 3300026476|Ga0256808_1063417 | Not Available | 555 | Open in IMG/M |
| 3300027683|Ga0209392_1000586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 8605 | Open in IMG/M |
| 3300027683|Ga0209392_1002826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4785 | Open in IMG/M |
| 3300027683|Ga0209392_1008605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 3073 | Open in IMG/M |
| 3300027683|Ga0209392_1020234 | All Organisms → cellular organisms → Bacteria | 2117 | Open in IMG/M |
| 3300027683|Ga0209392_1027141 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300027683|Ga0209392_1032959 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
| 3300027693|Ga0209704_1013636 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300027693|Ga0209704_1071913 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300027719|Ga0209467_1216595 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300027721|Ga0209492_1011982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 2909 | Open in IMG/M |
| 3300027721|Ga0209492_1084340 | Not Available | 1121 | Open in IMG/M |
| 3300027721|Ga0209492_1132404 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300027762|Ga0209288_10009813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2686 | Open in IMG/M |
| 3300027871|Ga0209397_10021521 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
| 3300027871|Ga0209397_10083467 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira | 1297 | Open in IMG/M |
| 3300027871|Ga0209397_10130608 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300027871|Ga0209397_10131096 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300027871|Ga0209397_10139635 | Not Available | 1065 | Open in IMG/M |
| 3300027871|Ga0209397_10210980 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300027871|Ga0209397_10604287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 549 | Open in IMG/M |
| 3300027877|Ga0209293_10722290 | Not Available | 528 | Open in IMG/M |
| 3300027885|Ga0209450_10000370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 23711 | Open in IMG/M |
| 3300027885|Ga0209450_10034128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3018 | Open in IMG/M |
| 3300027885|Ga0209450_10117147 | Not Available | 1795 | Open in IMG/M |
| 3300027885|Ga0209450_10197639 | Not Available | 1418 | Open in IMG/M |
| 3300027885|Ga0209450_10876996 | Not Available | 643 | Open in IMG/M |
| 3300027885|Ga0209450_10884016 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira | 640 | Open in IMG/M |
| 3300027885|Ga0209450_11136340 | Not Available | 546 | Open in IMG/M |
| 3300027890|Ga0209496_10574136 | Not Available | 607 | Open in IMG/M |
| 3300027890|Ga0209496_10789879 | Not Available | 524 | Open in IMG/M |
| 3300027897|Ga0209254_10001094 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 23891 | Open in IMG/M |
| 3300027897|Ga0209254_10650966 | Not Available | 734 | Open in IMG/M |
| 3300027897|Ga0209254_10735782 | Not Available | 676 | Open in IMG/M |
| 3300027899|Ga0209668_10001227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 10910 | Open in IMG/M |
| 3300027899|Ga0209668_10165327 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300027956|Ga0209820_1130259 | Not Available | 691 | Open in IMG/M |
| 3300027975|Ga0209391_10004813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 7192 | Open in IMG/M |
| 3300027975|Ga0209391_10067933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1639 | Open in IMG/M |
| 3300027975|Ga0209391_10207577 | Not Available | 810 | Open in IMG/M |
| 3300033406|Ga0316604_10102294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 1506 | Open in IMG/M |
| 3300033406|Ga0316604_10188092 | Not Available | 1112 | Open in IMG/M |
| 3300033406|Ga0316604_10368999 | Not Available | 786 | Open in IMG/M |
| 3300033406|Ga0316604_10452408 | Not Available | 705 | Open in IMG/M |
| 3300033406|Ga0316604_10557680 | Not Available | 630 | Open in IMG/M |
| 3300033406|Ga0316604_10795918 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira | 519 | Open in IMG/M |
| 3300033408|Ga0316605_10190569 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300033408|Ga0316605_12220493 | Not Available | 534 | Open in IMG/M |
| 3300033413|Ga0316603_10289859 | Not Available | 1441 | Open in IMG/M |
| 3300033413|Ga0316603_10472563 | Not Available | 1146 | Open in IMG/M |
| 3300033413|Ga0316603_10524727 | Not Available | 1090 | Open in IMG/M |
| 3300033413|Ga0316603_10745386 | Not Available | 917 | Open in IMG/M |
| 3300033413|Ga0316603_11144634 | Not Available | 736 | Open in IMG/M |
| 3300033413|Ga0316603_11542084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 630 | Open in IMG/M |
| 3300033413|Ga0316603_12031194 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300033414|Ga0316619_10485498 | Not Available | 1002 | Open in IMG/M |
| 3300033414|Ga0316619_10647445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
| 3300033414|Ga0316619_10839337 | Not Available | 788 | Open in IMG/M |
| 3300033414|Ga0316619_11123111 | Not Available | 690 | Open in IMG/M |
| 3300033416|Ga0316622_100001264 | All Organisms → cellular organisms → Bacteria | 16238 | Open in IMG/M |
| 3300033416|Ga0316622_100057753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 3686 | Open in IMG/M |
| 3300033416|Ga0316622_100093057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 2998 | Open in IMG/M |
| 3300033416|Ga0316622_100790288 | Not Available | 1102 | Open in IMG/M |
| 3300033416|Ga0316622_102591116 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300033416|Ga0316622_103331527 | Not Available | 507 | Open in IMG/M |
| 3300033418|Ga0316625_100574386 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300033419|Ga0316601_100279428 | Not Available | 1517 | Open in IMG/M |
| 3300033419|Ga0316601_101018396 | Not Available | 827 | Open in IMG/M |
| 3300033419|Ga0316601_101985157 | Not Available | 586 | Open in IMG/M |
| 3300033419|Ga0316601_102407205 | Not Available | 530 | Open in IMG/M |
| 3300033434|Ga0316613_10558948 | Not Available | 780 | Open in IMG/M |
| 3300033481|Ga0316600_10608381 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300033482|Ga0316627_100834392 | Not Available | 875 | Open in IMG/M |
| 3300033482|Ga0316627_101178198 | Not Available | 756 | Open in IMG/M |
| 3300033482|Ga0316627_101477255 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300033485|Ga0316626_10243617 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300033487|Ga0316630_10189598 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300033487|Ga0316630_11920588 | Not Available | 542 | Open in IMG/M |
| 3300033487|Ga0316630_12016053 | Not Available | 530 | Open in IMG/M |
| 3300033493|Ga0316631_10070539 | Not Available | 1179 | Open in IMG/M |
| 3300033521|Ga0316616_100773375 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300033557|Ga0316617_100446075 | Not Available | 1157 | Open in IMG/M |
| 3300033557|Ga0316617_101033096 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300034052|Ga0373889_048700 | Not Available | 659 | Open in IMG/M |
| 3300034055|Ga0373892_025389 | Not Available | 743 | Open in IMG/M |
| 3300034420|Ga0373918_0083736 | Not Available | 799 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 21.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 19.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 12.39% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 9.17% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 8.26% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 6.42% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 6.42% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 3.21% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 2.29% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.83% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 1.38% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.38% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.92% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.92% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.46% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.46% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.46% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.46% |
| Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 0.46% |
| Rice Endophytes | Host-Associated → Plants → Rhizoplane → Endophytes → Unclassified → Rice Endophytes | 0.46% |
| Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.46% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2010549000 | Rice endophytes microbial communities from Berkeley, California, USA | Host-Associated | Open in IMG/M |
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300004026 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 | Environmental | Open in IMG/M |
| 3300004048 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004049 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004051 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004071 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004146 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004154 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009430 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300009776 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG | Engineered | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300014264 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd | Environmental | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014298 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014306 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1 | Environmental | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014313 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300021346 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.374 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025106 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes) | Environmental | Open in IMG/M |
| 3300025561 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025706 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025950 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025956 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025964 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025966 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025968 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026476 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR6 | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027719 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034052 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.2 | Engineered | Open in IMG/M |
| 3300034055 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.2 | Engineered | Open in IMG/M |
| 3300034420 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.1 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RicEn_592700 | 2010549000 | Rice Endophytes | MFTCKSYDKFTARVLAGLVLAVTIVFGSLTYAVSNVQAYI |
| Ga0031656_100007296 | 3300003858 | Freshwater Lake Sediment | MFTCNNVDRFTTRVLAGLVVSVTIVFGSLTYAVSNIQAYA* |
| Ga0031656_100095763 | 3300003858 | Freshwater Lake Sediment | MFTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNIQVFA* |
| Ga0031656_100124622 | 3300003858 | Freshwater Lake Sediment | MFTCKSADRFTTRILAGLVVAVAIMFGSLTHAVVNFQAFA* |
| Ga0031656_100171394 | 3300003858 | Freshwater Lake Sediment | MFTCSNADSFTTRILAGLVVSVMIVMGSLTYAVANIQTFA* |
| Ga0031656_101207121 | 3300003858 | Freshwater Lake Sediment | MFACKNVDRFTTRILAGLVVAVTIVFGSLTHAVAGLQAFA* |
| Ga0031653_100823942 | 3300003859 | Freshwater Lake Sediment | MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQVYA* |
| Ga0055443_101586921 | 3300004026 | Natural And Restored Wetlands | MFTCKNVDSFTARVLSGLVVSVTIVFGSLTYAVSHMQAFA* |
| Ga0055494_100001772 | 3300004048 | Natural And Restored Wetlands | MFTCNSADRFTTRVLAGLVVAATILFGSLTHAVVNFQAFA* |
| Ga0055494_100117212 | 3300004048 | Natural And Restored Wetlands | MFTCSNNDRFATRVLAGLVVTVAIVMGSLTYAVSNIQAFA* |
| Ga0055494_100472921 | 3300004048 | Natural And Restored Wetlands | MFTCNSVDTFTTRVLAGLVLAVTVVLGSLTHAVANMQAFV* |
| Ga0055493_100152662 | 3300004049 | Natural And Restored Wetlands | MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAYA* |
| Ga0055493_100870892 | 3300004049 | Natural And Restored Wetlands | MFTCKSYDKFAARVLAGLVLAVTIVFGSLTYAVSNVQAYI* |
| Ga0055493_101710691 | 3300004049 | Natural And Restored Wetlands | MFTCNNVDRFTARVLSGLVVSVTIVFGSLTYAVSHMQAFA* |
| Ga0055491_100376502 | 3300004050 | Natural And Restored Wetlands | MFSCNHADAFTTRILAGLVLAVTVVIGSLTFAVANIQVVA* |
| Ga0055492_100148631 | 3300004051 | Natural And Restored Wetlands | EDQAMFTCNSADRFTTRVLAGLVVAATILFGSLTHAVVNFQAFA* |
| Ga0055486_101091722 | 3300004071 | Natural And Restored Wetlands | MFTCNNVDRFTARILSGLVVSVTIVFGSLTYAVSHMQAFA* |
| Ga0055495_100505432 | 3300004146 | Natural And Restored Wetlands | MFSCNHADAFTTRILAGLVLAVTVVIGSLTYAVANIQVVA* |
| Ga0066603_100492133 | 3300004154 | Freshwater | MLTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA* |
| Ga0069718_100176992 | 3300004481 | Sediment | MFTCNNADRFTTRVLAGLVVTVTIVFGSLTYAVSNIQVYA* |
| Ga0069718_146874512 | 3300004481 | Sediment | MFTCIKADKFTTRVLAGLVVTVTIVFGSLTHAVSNVQAFA* |
| Ga0079037_10000001016 | 3300006224 | Freshwater Wetlands | MFTCNATDRFASRVLAGLVLAVTIVMGSLTYAVANIQAYA* |
| Ga0079037_1000001647 | 3300006224 | Freshwater Wetlands | MFTCKTYDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQTYI* |
| Ga0079037_1000028333 | 3300006224 | Freshwater Wetlands | MFSCNHADAFTTRILAGLVLAVTIVVGSLTYAVANIQVVA* |
| Ga0079037_1000311572 | 3300006224 | Freshwater Wetlands | MLTCNETDRFTTRVLAGLVLAVTVVMGSLTYAVANIQAFA* |
| Ga0079037_1000451574 | 3300006224 | Freshwater Wetlands | MTTCTKYDRFSTRLFAGLVIAVTIVMGSLTYALSHVQVYA* |
| Ga0079037_1000638612 | 3300006224 | Freshwater Wetlands | MFTCSNNDRFATRVFAGLVVTVAIVMGSLTYAVSNIQAFA* |
| Ga0079037_1000892401 | 3300006224 | Freshwater Wetlands | TCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA* |
| Ga0079037_1001316943 | 3300006224 | Freshwater Wetlands | MFTCNDTDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA* |
| Ga0079037_1001357663 | 3300006224 | Freshwater Wetlands | MFTCSNNDRFAARVLAGLVITVTIVMGSLTYAVSNIQAFA* |
| Ga0079037_1002722172 | 3300006224 | Freshwater Wetlands | MFANCNNTDRFTVRLFAGLVVTVAMVMGSLTYAVANIQVFA* |
| Ga0079037_1003660562 | 3300006224 | Freshwater Wetlands | MFTCSNADSFTTRILAGLVVSVMIVMGSLTYAVANIQAFA* |
| Ga0079037_1004909072 | 3300006224 | Freshwater Wetlands | TMFTCNDTDRFTTRILAGLVLAVTIVVGSLTHAVANIQMFA* |
| Ga0079037_1006526102 | 3300006224 | Freshwater Wetlands | MFTCKSYDKFTTRVLAGLVITVAVAFGSLVHAVSNIETYI* |
| Ga0079037_1010277422 | 3300006224 | Freshwater Wetlands | MLTCKTTDRFAARVFAGLVLTVAVVMGSLTYAVAHMQAYA* |
| Ga0079037_1012712122 | 3300006224 | Freshwater Wetlands | MFTCTDTDRFTTRILAGLVLAVTIVVGSLTHAVANIQMFA* |
| Ga0079037_1015493132 | 3300006224 | Freshwater Wetlands | MFTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNMQVFA* |
| Ga0079037_1017674652 | 3300006224 | Freshwater Wetlands | MLTCNETDRFTTRVLAGLVLAVTIVMGSLTYAVANIQTFA* |
| Ga0079037_1019325101 | 3300006224 | Freshwater Wetlands | MFTCNRIDRFTTRVLAGLVLAVTIVVGSLTYAVANIQVIA* |
| Ga0079037_1019344092 | 3300006224 | Freshwater Wetlands | MFASCSNTDRFTVRLFAGLVVTVAMVMGSLTYAVANIQVFA* |
| Ga0105105_100019373 | 3300009009 | Freshwater Sediment | MFTCNEVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAYA* |
| Ga0105105_100219404 | 3300009009 | Freshwater Sediment | MFTCTDTDRFTTRVLAGLVIAVTIVVGSLTHAVIGIQAFA* |
| Ga0105105_105738521 | 3300009009 | Freshwater Sediment | MFTCKSYDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQTYI* |
| Ga0105093_107659511 | 3300009037 | Freshwater Sediment | MEDPKMFTCNNVDRFTTRVLAGLVVSVTIVFGSLTYAVSNMQAYA* |
| Ga0105090_100011024 | 3300009075 | Freshwater Sediment | MFSCNHADAFTTRILAGLVLAVTIVMGSLTYAVANIQVVA* |
| Ga0105090_100034235 | 3300009075 | Freshwater Sediment | MFTCKSYDKFTTRVLAGLVLAVTIVVGSLTHAVSNIETYI* |
| Ga0105090_100040652 | 3300009075 | Freshwater Sediment | MFTCKSYDKFTTRVLAGLVITVAVAFGSLVHAVSSIETYI* |
| Ga0105090_100105836 | 3300009075 | Freshwater Sediment | MLTCTDTDRFTTRILAGLVLAVTIVLGSLTHAVTNIQAFA* |
| Ga0105090_100265624 | 3300009075 | Freshwater Sediment | MFTCNDTDRFTTRVLAGLVLAVTIVMGSLTYAVTNIQAFA* |
| Ga0105090_100480712 | 3300009075 | Freshwater Sediment | MFTCKTCDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQTYI* |
| Ga0105090_100924392 | 3300009075 | Freshwater Sediment | MFTCTDTDRFTTRVLAGLVLAVTIVVGSLTHAVTNIQTFA* |
| Ga0105090_101252673 | 3300009075 | Freshwater Sediment | MFSCNHADSFTTRVLAGLVLAVTIVIGSLTYAVANIQVVA* |
| Ga0105106_100728942 | 3300009078 | Freshwater Sediment | MFTCKTCDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQAYI* |
| Ga0105106_103666412 | 3300009078 | Freshwater Sediment | MFTCNNVDRFTTRVLAGLVVSVTIVFGSLTYAVSNMQAYA* |
| Ga0105106_103812142 | 3300009078 | Freshwater Sediment | MITCSNADSFTTRILAGLVVSVMIVMGSLTYAVANIQTFA* |
| Ga0105098_100781513 | 3300009081 | Freshwater Sediment | EDPTMFTCNNVDRFTTRVLAGLVVTVTIVFGSLTHAVSNIQAYA* |
| Ga0105099_107363272 | 3300009082 | Freshwater Sediment | KTCDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQTYI* |
| Ga0105103_101459442 | 3300009085 | Freshwater Sediment | MEDPKMFTCNNVDRFTTRVLAGLVVTVTIVFGSLTHAVSNIHAYA* |
| Ga0102851_104180792 | 3300009091 | Freshwater Wetlands | MFTCSNADSFTTRIVAGLVVSVMIVMGSLTYAVANIQAFA* |
| Ga0102851_105247232 | 3300009091 | Freshwater Wetlands | FTCKSYDKFTTRVLAGLVITVAVAFGSLVHAVSNIETYI* |
| Ga0102851_108240691 | 3300009091 | Freshwater Wetlands | MLTCNESDRFATRVMAGLVIAVTIVMGSLPYAVANTQAFA* |
| Ga0102851_111507332 | 3300009091 | Freshwater Wetlands | MLTCNENDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA* |
| Ga0102851_117227181 | 3300009091 | Freshwater Wetlands | MTTCNKYDRFSTRILAGLVIAVTIVFGSLTYALSNVQAYA* |
| Ga0102851_131279371 | 3300009091 | Freshwater Wetlands | MSTCKNVDRFTTRILAGLVVAVTIVIGSLTHAVSGLQAFA* |
| Ga0115026_109833172 | 3300009111 | Wetland | AMLTCNETDRFTTRVLAGLVLAVTVVMGSLTYAVANIQAFA* |
| Ga0117941_10001467 | 3300009120 | Lake Sediment | MFTCTDSDRYTTRILAGLVLAVTIVVGSLTHAVSNLQTFA* |
| Ga0115027_107150312 | 3300009131 | Wetland | MFTCKSYDKFATRVLAGLVLAVTIVFGSLTYAVSNVQAYI* |
| Ga0105094_101087622 | 3300009153 | Freshwater Sediment | MFTCNDTDRFTTRVLAGLVLAVTIVVGSLTYAVTNIQAFA* |
| Ga0105102_102162462 | 3300009165 | Freshwater Sediment | MFTCKSYDKFTTRVLAGLVLAVTIVFGSLTHAVSNIETYI* |
| Ga0105102_104506082 | 3300009165 | Freshwater Sediment | MFTCTDTDRFTTRILAGLVLAVTIVLGSLTHAVTNIQAFA* |
| Ga0105100_105934912 | 3300009166 | Freshwater Sediment | EDPIVFSCTHADAFTTRVLAGLVLAVTIVMGSLTYAVANIQVVA* |
| Ga0105100_108084362 | 3300009166 | Freshwater Sediment | MFTCKTCDKFNTRVLAGLVLTVTIVVGSLTHAVSNVQAYI* |
| Ga0113563_103005822 | 3300009167 | Freshwater Wetlands | MEDSAMTTCNKYDRFSTRILAGLVIAVTIVFGSLTYALSNVQAYA* |
| Ga0113563_103060863 | 3300009167 | Freshwater Wetlands | MFTCTDTDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA* |
| Ga0105097_101729422 | 3300009169 | Freshwater Sediment | MFSCKHADAFTTRILAGLVLAVTIVMGSLTYAVANIQVVA* |
| Ga0105097_102485942 | 3300009169 | Freshwater Sediment | MLTCNDTDRFTTRILAGLVLAVTIVLGSLTHAVTNIQAFA* |
| Ga0105096_101190941 | 3300009170 | Freshwater Sediment | MFTCKTCDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQAY |
| Ga0105096_104023222 | 3300009170 | Freshwater Sediment | MFTCTDTDRFTTRILAGLVLAVTIVLGSLTHAVTNIQ |
| Ga0115028_100100282 | 3300009179 | Wetland | MFTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNIQAYA* |
| Ga0114938_10077433 | 3300009430 | Groundwater | MFTCNSADRFTNRILAGLVVAVAIMFGSLTHAVVNFQAFA* |
| Ga0114938_10270262 | 3300009430 | Groundwater | MFTCNETDRFTSRLLAGLVLAVTIVVGSLTHAVSSIQTFA* |
| Ga0118657_101295474 | 3300009506 | Mangrove Sediment | MLTCSQTDRFTTRIFAGLVVSVTIAFGSLMYAVSNLQIVA* |
| Ga0118657_102797943 | 3300009506 | Mangrove Sediment | MLTCSQTDRYTSRVLAGLVLAVTIVFGSLTYAVANLQIVA* |
| Ga0123573_100206482 | 3300009509 | Mangrove Sediment | MLTCTTADRFTTHILAGLVLAVTIVMGSLTYAVANIQVIA* |
| Ga0123573_100614482 | 3300009509 | Mangrove Sediment | MLTCSQTDRYTSRVLAGLVLAVTIVFGSLTYAVANMQIVA* |
| Ga0123573_102171503 | 3300009509 | Mangrove Sediment | MEDPSMITCSNVDRFTSRVLAGLVVAVTIVFGSLTYAVTHVQAFA* |
| Ga0123573_107386962 | 3300009509 | Mangrove Sediment | MFTCTETDRFTTRVLAGLVLAVTIAMGSLTYAVTNIQAFA* |
| Ga0116154_100263851 | 3300009776 | Anaerobic Digestor Sludge | MFTCNNVDRFTTRVLAGLVITVTIAFGSLTYAVSNIQAYA* |
| Ga0116154_103300852 | 3300009776 | Anaerobic Digestor Sludge | MLTCNENDRFAARILAGLVITVTIVMGSLTYAVANIQAFA* |
| Ga0130016_100189616 | 3300009868 | Wastewater | MPATRKYDSYTNRVFAGLVIAVTIVVGSLAYAASNVQAYV* |
| Ga0130016_101403101 | 3300009868 | Wastewater | MPATRKCDRYTNRVLAGLVIAVSIVVGSLTYAVSNIQVYV* |
| Ga0130016_103683432 | 3300009868 | Wastewater | MPATRKCDSYTNRVLAGLVIAVSIVVGSLAYAVSNVQAYV* |
| Ga0133939_10055506 | 3300010051 | Industrial Wastewater | MFTCTDSDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA* |
| Ga0136852_102268792 | 3300010412 | Mangrove Sediment | MFTCTDTDRFTTRVLAGLVLAVTIVMGSLTYAVTNIQAFV* |
| Ga0136852_102791712 | 3300010412 | Mangrove Sediment | MFTCNSVDTFTTRILAGLVLAVTVVLGSLTHAVANMQAFV* |
| Ga0136852_107943512 | 3300010412 | Mangrove Sediment | MLTCNATDRFTTHILAGLVLAVTIVMGSLTYAVANVQAFA* |
| Ga0075308_10795892 | 3300014264 | Natural And Restored Wetlands | MFTRNNTDRFTTRVVASLVVVATILFGSLTHAVVNFQAFA* |
| Ga0075344_10571852 | 3300014296 | Natural And Restored Wetlands | MFTCNNVDRFTTRVLAGLVLSVTIVMGSLAYAVSHIQVVA* |
| Ga0075341_11239661 | 3300014298 | Natural And Restored Wetlands | MFTCNSADRFTTRVLAGLVVAATILFGSLTHAVVNSQAFA* |
| Ga0075346_11753472 | 3300014306 | Natural And Restored Wetlands | ADRFTTRVLAGLVVAATILFGSLTHAVVNFQAFA* |
| Ga0075345_10125681 | 3300014312 | Natural And Restored Wetlands | MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA* |
| Ga0075345_11459612 | 3300014312 | Natural And Restored Wetlands | MFTCKSVDSFTARVLSGLVVSVTIVFGSLTYAVSHMQAFA* |
| Ga0075345_11660382 | 3300014312 | Natural And Restored Wetlands | MFTCKSYDKFTARVLAGLVLAVTIVFGSLTYAVSNVQAYI* |
| Ga0075347_10249252 | 3300014313 | Natural And Restored Wetlands | MLTCNETDRFTTRVLAGLVLAVTVVLGSLTHAVANMQAFV* |
| Ga0075347_11399312 | 3300014313 | Natural And Restored Wetlands | MFTCKNYDKFTTRVLAGLVLAVTSVVGSLTHAVSNIETYI* |
| Ga0075339_11227851 | 3300014316 | Natural And Restored Wetlands | MFTCKNYDKFATRVLTGLVLAVTIVVGSLTHAVSNIETYI* |
| Ga0075348_10110851 | 3300014319 | Natural And Restored Wetlands | VDRFTTRVLAGLVVSVTIVFGSLTYAVSNIQAYA* |
| Ga0075348_10643852 | 3300014319 | Natural And Restored Wetlands | MFTCNNVDRFTTRVLAGLVLAVTIVMGSLTHAVTNIQAFA* |
| Ga0075348_10732362 | 3300014319 | Natural And Restored Wetlands | DQTMFTCKNVDSFTARVLSGLVVSVTIVFGSLTYAVSHMQAFA* |
| Ga0075348_11158642 | 3300014319 | Natural And Restored Wetlands | MFTCKNYDKFTTRVLAGLVVTVAVVFGSLVHAVSNIETYI* |
| Ga0207193_12243212 | 3300020048 | Freshwater Lake Sediment | MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQVYA |
| Ga0210335_14316682 | 3300021346 | Estuarine | MFTCNNVDRFTARILSGLVVSVTIVFGSLTYAVSHMQAFA |
| Ga0224500_100095212 | 3300022213 | Sediment | MLTCNETDRYTARILAGLVLAVTIVMGSLTYAVANIQAYA |
| Ga0209398_10132313 | 3300025106 | Groundwater | MFTCNSADRFTNRILAGLVVAVAIMFGSLTHAVVNFQAFA |
| Ga0209398_10166792 | 3300025106 | Groundwater | MFTCNETDRFTSRLLAGLVLAVTIVVGSLTHAVSSIQTFA |
| Ga0210119_10675551 | 3300025561 | Natural And Restored Wetlands | MFTCKNVDSFTARVLSGLVVSVTIVFGSLTYAVSHMQAFA |
| Ga0209507_10987532 | 3300025706 | Anaerobic Digestor Sludge | MFTCNNVDRFTTRVLAGLVITVTIAFGSLTYAVSNIQAYA |
| Ga0209310_12280322 | 3300025715 | Anaerobic Digestor Sludge | MLTCNENDRFAARILAGLVITVTIVMGSLTYAVANIQAFA |
| Ga0209310_12395192 | 3300025715 | Anaerobic Digestor Sludge | MLTCNENDRFAARILAGLVITVTIVMGSLTYAVNNIQAFA |
| Ga0210134_10065201 | 3300025950 | Natural And Restored Wetlands | MFTCNSADRFTTRVLAGLVVAATILFGSLTHAVVNFQAFA |
| Ga0210134_10394141 | 3300025950 | Natural And Restored Wetlands | MFTCSNNDRFATRVLAGLVVTVAIVMGSLTYAVSHMQAFA |
| Ga0210104_10098082 | 3300025956 | Natural And Restored Wetlands | MFTCSNNDRFATRVLAGLVVAATILFGSLTHAVVNFQAFA |
| Ga0210127_10327801 | 3300025964 | Natural And Restored Wetlands | MFTCNNVDRFTARVLSGLVVSVTIVFGSLTYAVSNIQAFA |
| Ga0210105_10012103 | 3300025966 | Natural And Restored Wetlands | MFTCNSADRFTTRVLAGLVVTVAIVMGSLTYAVSNIQAFA |
| Ga0210103_10034202 | 3300025968 | Natural And Restored Wetlands | MFTCSNNDRFATRVLAGLVVTVAIVMGSLTYAVSNIQAFA |
| Ga0210103_10104112 | 3300025968 | Natural And Restored Wetlands | MFTCKSYDKFAARVLAGLVLAVTIVFGSLTYAVSNVQAYI |
| Ga0210103_10720652 | 3300025968 | Natural And Restored Wetlands | MFTCNNVDRFTARVLSGLVVSVTIVFGSLTYAVSHMQAFA |
| Ga0256808_10634172 | 3300026476 | Sediment | MFTCNNVDRFSTRVFAGLVVAVTILFGSLTHAVVNFQAFA |
| Ga0209392_10005866 | 3300027683 | Freshwater Sediment | MFTCKTCDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQTYI |
| Ga0209392_10028264 | 3300027683 | Freshwater Sediment | MFTCKTCDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQAYI |
| Ga0209392_10086053 | 3300027683 | Freshwater Sediment | MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTHAVSNIQAYA |
| Ga0209392_10202343 | 3300027683 | Freshwater Sediment | MFSCKHADAFTTRILAGLVLAVTIVMGSLTYAVANIQVVA |
| Ga0209392_10271412 | 3300027683 | Freshwater Sediment | MFTCNNVDRFTTRVLAGLVVSVTIVFGSLTYAVSNMQAYA |
| Ga0209392_10329593 | 3300027683 | Freshwater Sediment | MFTCKSYDKFTTRVLAGLVLAVTIVVGSLTHAVSNIETYI |
| Ga0209704_10136362 | 3300027693 | Freshwater Sediment | MFTCNEVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAYA |
| Ga0209704_10719132 | 3300027693 | Freshwater Sediment | MFTCKNYDKFTTRVLAGLVITVAVAFGSLVHAVSSIETYI |
| Ga0209467_12165952 | 3300027719 | Freshwater | MLTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA |
| Ga0209492_10119823 | 3300027721 | Freshwater Sediment | MFTCSNADSFTTRILAGLVVSVMIVMGSLTYAVANIQTFA |
| Ga0209492_10843402 | 3300027721 | Freshwater Sediment | MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAYA |
| Ga0209492_11324042 | 3300027721 | Freshwater Sediment | MFANCNNTDRFTVRLFAGLVVTVAMVMGSLTYAVANIQVFA |
| Ga0209288_100098132 | 3300027762 | Freshwater Sediment | MFTCTDTDRFTTRVLAGLVIAVTIVVGSLTHAVIGIQAFA |
| Ga0209397_100215213 | 3300027871 | Wetland | MLTCNENDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA |
| Ga0209397_100834672 | 3300027871 | Wetland | MFTCKSYDKFTTRVLAGLVITVAVAFGSLVHAVSNIETYI |
| Ga0209397_101306081 | 3300027871 | Wetland | MLTCNETDRFTTRVLAGLVLAVTVVMGSLTYAVANIQAFA |
| Ga0209397_101310962 | 3300027871 | Wetland | MFTCSNNDRFATRVFAGLVVTVAIVMGSLTYAVSNIQAFA |
| Ga0209397_101396352 | 3300027871 | Wetland | MFTCKTYDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQTYI |
| Ga0209397_102109802 | 3300027871 | Wetland | MFTCSNADSFTTRILAGLVVSVMIVMGSLTYAVANIQAFA |
| Ga0209397_106042871 | 3300027871 | Wetland | MFTCNDTDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA |
| Ga0209293_100458202 | 3300027877 | Wetland | MTTCTKYDRFSTRLFAGLVIAVTIVMGSLTYALSHVQVYA |
| Ga0209293_107222902 | 3300027877 | Wetland | TQEDLAMLTCNETDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA |
| Ga0209450_100003705 | 3300027885 | Freshwater Lake Sediment | MFTCSNSDRFTVRILAGLVVTVALVMGSLTYAVANIQVVA |
| Ga0209450_100341283 | 3300027885 | Freshwater Lake Sediment | MTTCKNVDRYTARILAGLVIAVTIVLGALTHAVSNVQAFA |
| Ga0209450_101171472 | 3300027885 | Freshwater Lake Sediment | MFTCNNVDRFTTRVLAGLVVSVTIVFGSLTYAVSNIQAYA |
| Ga0209450_101976392 | 3300027885 | Freshwater Lake Sediment | MFTCKSADRFTTRILAGLVVAVAIMFGSLTHAVVNFQAFA |
| Ga0209450_108769961 | 3300027885 | Freshwater Lake Sediment | MFTCIKADKFTTRVLAGLVVTVTIVFGSLTHAVSNVQAFA |
| Ga0209450_108840161 | 3300027885 | Freshwater Lake Sediment | MFTCNNADRFTTRILAGLVVAVTIVFGSLTHAVVNLQAFA |
| Ga0209450_111363402 | 3300027885 | Freshwater Lake Sediment | MFTRCHNADRFTVRILAGLVVTVAMVMGSLTYAVANMQAFA |
| Ga0209496_105741362 | 3300027890 | Wetland | MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSHMQAFA |
| Ga0209496_107898791 | 3300027890 | Wetland | MFTCSNADSFTTRIVAGLVVSVMIVMGSLTYAVANIQAFA |
| Ga0209254_100010944 | 3300027897 | Freshwater Lake Sediment | MFTCKSYDKFTTRVLAGLVLAVTIVVGSLTHAVSNVQAYI |
| Ga0209254_106509662 | 3300027897 | Freshwater Lake Sediment | MMTCSNADSFTVRLLAGLVVGVMIVMGSLTYAVANIQTYA |
| Ga0209254_107357821 | 3300027897 | Freshwater Lake Sediment | MFTCSNADSFTTRIFAGLVVSVMIVMGSLTYAVANIQTFA |
| Ga0209668_100012276 | 3300027899 | Freshwater Lake Sediment | MLTCNETDRFATRVLAGLVIAVTIVMGSLTYAVANIQAYA |
| Ga0209668_101653272 | 3300027899 | Freshwater Lake Sediment | MLTCNESDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA |
| Ga0209820_11302592 | 3300027956 | Freshwater Sediment | MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNI |
| Ga0209391_100048136 | 3300027975 | Freshwater Sediment | MLTCTDTDRFTTRILAGLVLAVTIVLGSLTHAVTNIQAFA |
| Ga0209391_100679333 | 3300027975 | Freshwater Sediment | MFSCNHADSFTTRVLAGLVLAVTIVIGSLTYAVANIQVVA |
| Ga0209391_102075772 | 3300027975 | Freshwater Sediment | MFTCTDTDRFTTRVLAGLVLAVTIVVGSLTHAVTNIQTFA |
| Ga0316604_101022941 | 3300033406 | Soil | MFTCTNTDRFTTRILAGLVLAVTIVVGSLTHAVSNIQTFA |
| Ga0316604_101880921 | 3300033406 | Soil | MFTCTDTDRFTTRILAGLVLAVTIVVGSLTHAVANIQMFA |
| Ga0316604_103689991 | 3300033406 | Soil | MTTCNKYDRFSTRILAGLVIAVTIVFGSLTYALSNVQAYA |
| Ga0316604_104524082 | 3300033406 | Soil | MFTCNATDRFASRVLAGLVLAVTIVMGSLTYAVANIQAYA |
| Ga0316604_105576802 | 3300033406 | Soil | MFTCSNNDRFAARVLAGLVITVTIVMGSLTYAVSNIQAFA |
| Ga0316604_107959182 | 3300033406 | Soil | ATEDPTMFTCKSYDKFTTRILAGLVITVAVAFGSLVHAVSNIETYI |
| Ga0316605_101905692 | 3300033408 | Soil | MFTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNMQVFA |
| Ga0316605_122204931 | 3300033408 | Soil | MFSCNHADAFTTRILAGLVLAVTIVVGSLTYAVANIQVVA |
| Ga0316603_100009491 | 3300033413 | Soil | MTTCTKYDRFSTRLFAGLVIAVTIVMGSLTYALSHVHVYA |
| Ga0316603_101683461 | 3300033413 | Soil | MPARQKCNSYTHRVFAGLVIAVTIVAGSLVYAVSNVQVYV |
| Ga0316603_102898592 | 3300033413 | Soil | MFTCKSYDKFATRVLAGLVLAVTIVFGSLTYAVSNVQAYI |
| Ga0316603_104725631 | 3300033413 | Soil | FTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNMQVFA |
| Ga0316603_105247271 | 3300033413 | Soil | MFTCNNVDSFTTRVLAGLVVTVTMVFGSLTYAVSNIQAFA |
| Ga0316603_107453862 | 3300033413 | Soil | MFTCKSYDKFTTRILAGLVITVAVAFGSLVHAVSNIETYI |
| Ga0316603_111446342 | 3300033413 | Soil | WPPHATEDPKMFTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNMQVFA |
| Ga0316603_115420841 | 3300033413 | Soil | MLTCNETDRFTTRVLAGLVLAVTIVMGSLTYAVANIQTFA |
| Ga0316603_120311941 | 3300033413 | Soil | MLTCNENDRFATRVLAGLVITVTIVMGSLTYAVAT |
| Ga0316619_104854982 | 3300033414 | Soil | MFASCSNTDRFTVRLFAGLVVTVAMVMGSLTYAVANIQVFA |
| Ga0316619_106474451 | 3300033414 | Soil | MTTCNKYDRFSTRVLAGLVIAVTIVMGSLTYALSHVQAYA |
| Ga0316619_108393371 | 3300033414 | Soil | MLTCNENDRFATRVLAGLVITVTIVMGSLTYAVAN |
| Ga0316619_111231111 | 3300033414 | Soil | TCNENDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA |
| Ga0316622_1000012641 | 3300033416 | Soil | NVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA |
| Ga0316622_1000577532 | 3300033416 | Soil | MFTCNNVDSFTTRILAGLVLAVTIVFGSLTYAVANMQAYA |
| Ga0316622_1000930571 | 3300033416 | Soil | TCNDTDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA |
| Ga0316622_1003569761 | 3300033416 | Soil | MFTCNDNDSFLTRILAGLVVAVTIVVGSLTHAVSNIQAFT |
| Ga0316622_1007902882 | 3300033416 | Soil | MRTCQNADRFTTRVLAGLVIAVTIVFGSLTHAVVNLQAFA |
| Ga0316622_1025911162 | 3300033416 | Soil | EDPTMFTCTDTDRFTTRILAGLVLAVTIVVGSLTHAVANIQMFA |
| Ga0316622_1033315272 | 3300033416 | Soil | MFTCTDTDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA |
| Ga0316625_1005743861 | 3300033418 | Soil | MLTCNETDRFTTRILAGLVLAVTIVMGSLTYAVSNIQTFA |
| Ga0316601_1002794282 | 3300033419 | Soil | MTTCNKYDRFSTRILAGLVIAVTIVFGSLAYALSNVQAYA |
| Ga0316601_1010183962 | 3300033419 | Soil | PHATEDPTMFTCNNVDSFTTRVLAGLVVTVAIVFSSLTYAVSNMQAFA |
| Ga0316601_1019851572 | 3300033419 | Soil | CNENDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA |
| Ga0316601_1024072052 | 3300033419 | Soil | MFSCNHADAFSTRILAGLVLAVTIVVGSLTYAVANIQVVA |
| Ga0316613_105589482 | 3300033434 | Soil | NVDSFTTRVLAGLVVTVTIVFGSLTYAVSHMQAFA |
| Ga0316600_106083811 | 3300033481 | Soil | MLTCNETDRFATRVLAGLVIAVTVVMGSLTYAVANIQAFA |
| Ga0316627_1008343921 | 3300033482 | Soil | WPPYATEDPTMFTCNDTDRFTTRILAGLVLAVTIVVGSLTHAVTNIQTFA |
| Ga0316627_1011781982 | 3300033482 | Soil | MFTCKNVDRFTTRILAGLVVAVTIVIGSLTHAVSGLQAFA |
| Ga0316627_1014772551 | 3300033482 | Soil | TCNETDRFTTRVLAGLVLAVTVVMGSLTYAVANIQAFA |
| Ga0316626_102436173 | 3300033485 | Soil | SNNDRFATRVFAGLVVTVAIVMGSLTYAVSNIQAFA |
| Ga0316630_101895981 | 3300033487 | Soil | MFTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA |
| Ga0316630_119205882 | 3300033487 | Soil | PTEDPTMFTCNATDRFASRVLAGLVLAVTIVMGSLTYAVANIQAYA |
| Ga0316630_120160532 | 3300033487 | Soil | DPKMLTCNNVDRFTTRVLAGLVVTVTIVFGSLTYAVSNIQAFA |
| Ga0316631_100705392 | 3300033493 | Soil | DLAMLTCNENDRFATRVLAGLVITVTIVMGSLTYAVANIQAFA |
| Ga0316616_1007733752 | 3300033521 | Soil | MFTCNDTDRFTTRILAGLVLAVTIVVGSLTHAVANIQMFA |
| Ga0316617_1004460751 | 3300033557 | Soil | FTCTNNDRFATRVLAGLVVTVAIVMGSLTYAVSNIQAFA |
| Ga0316617_1010330962 | 3300033557 | Soil | MFTCNDTDRFTTRILAGLVLAVTIVVGSLTHAITNIQTFA |
| Ga0316617_1017980651 | 3300033557 | Soil | MSTCTKYDRFSTRLFAGLVIAVTIVMGSLTYALSHVQVYA |
| Ga0373889_048700_68_190 | 3300034052 | Sediment Slurry | MFTFKSYDKFTARILAGLVLAVTIVFGSLTYAVSNVQAYI |
| Ga0373892_025389_305_424 | 3300034055 | Sediment Slurry | MFTCNNVDSFTTRVLAGLVVTVTIVFGSLTYAVSNIQVL |
| Ga0373918_0083736_121_246 | 3300034420 | Sediment Slurry | MFSTSNNFDRFTTRILAGLVVTVAIVMGSLTYAVANIQVVA |
| ⦗Top⦘ |