NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS015436_WUGC_scaffold_10522

Scaffold SRS015436_WUGC_scaffold_10522


Overview

Basic Information
Taxon OID7000000744 Open in IMG/M
Scaffold IDSRS015436_WUGC_scaffold_10522 Open in IMG/M
Source Dataset NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 764083206
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)518
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameNational Institutes of Health, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047508Metagenome149N

Sequences

Protein IDFamilyRBSSequence
SRS015436_WUGC_scaffold_10522__gene_9268F047508N/ASFDTEDVGWVVKRSKLCALMEHIYYLWGDTYALSKALCTVYEAVTNGIDLIEGLYEVLFFENVEDNLYAACVVRNVKVALNLLSFGVTEGDEGVVDPYALFVPRGQDLVVGELNEGELQGGAATVEDQDFHKVLYYMVRCVLIPSSP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.