NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS053854_LANL_scaffold_54731

Scaffold SRS053854_LANL_scaffold_54731


Overview

Basic Information
Taxon OID7000000687 Open in IMG/M
Scaffold IDSRS053854_LANL_scaffold_54731 Open in IMG/M
Source Dataset NameHuman tongue dorsum microbial communities from NIH, USA - visit 1, subject 508703490
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7640
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameNational Institutes of Health, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080164Metagenome115N
F103432Metagenome101N

Sequences

Protein IDFamilyRBSSequence
SRS053854_LANL_scaffold_54731__gene_85764F080164N/AMRPTSFVLSLLLGVIGLAPCAARQVTLRERALAFPLITEKDATEVDAPYAWRLPVVPLSLDNREIRNFAKYPLLPSLSGGILTVRVLVVGDTVAVHQDLMDDFAKRCRTTLGLGVRTAPKLFGIKGMHVYGVQKDGSRQAVDKQVTLHLPGFEKAEKPLHYKEQTGQLVLCEYYESHRGDLFLDVANAHPEIFGELCPVVDFHFPVELRRAYAWLLLEIELEDGTKLSTSLQHYDEQTSILDHPDRS
SRS053854_LANL_scaffold_54731__gene_85765F103432N/AMKLIHSLFSLPLLFVLGGLFCTTACQDDVEPTQRTGLISTDSLIHAAEVYDGKAFEHVVSTTATGLRVSEPRRVVPMLPRQLHVTMDGKTIFRRHTLPSVSAYSLQVVAVGDTIYRQKESDAQFNADLDALFRQSIGIAPRLFGVRELSVAGIDRKGKPRDLGNYSCPLLQGKRRNVNFRTKEGVFHEYFEAASVDTFSVKSNWLLKTKAEPSLYAPSFRLLVWEQPAEGCTKLRFTLTLVDGRSLVAEVPLR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.